File: 1537912030378.jpg (23.29 KB, 400x400, 2cLT4OR.jpg)
No. 696790
File: 1537912335404.png (94.2 KB, 673x600, whimsicott_oh_no.png)
No. 696798
It's unlikely Kero was hacked for various reasons. Here is a timeline of events that add up with the leaked telegram chatlogs.
>telegram Kero claims to be into vore.On Kero's twitter, it's pretty obvious from many of his tweets that he is into vore. He mentions it very often.
http://archive.is/DUPJuhttp://archive.is/wMrVmhttp://archive.is/1fpso
>telegram Kero claims to live near Pittsburgh.>twitter Kero lives in Pittsburgh. What a coincidence.View attachment 546276
http://archive.is/VMyIU
>Telegram Kero claims to be part of this other chat. If anyone else wants to look into that, be my guest.http://telegram.me/irlmawsandjawshttp://archive.is/5QUPi(edited)>Telegram Kero talks about how he just finished filming a video where he "just derps around in a fursuit."That appears to be referring to this video that Kero uploaded.
https://www.youtube.com/watch?v=SZUMuO2Z-4Uhttp://archive.is/o2BYwAccording to the logs, this message was sent on the 18th of August 2016.
>Kero's video was uploaded on September 13th, 2016. Less than a month later.
>telegram Kero talks about his dog who died of liver cancer. He mentions that the dog's name was Koda and that he is making a tribute video, but I couldn't find anything about this anywhere else.
>telegram Kero mentions that he is getting a bodysuit in a few weeks. This message was posted on June 6th.
>On YouTube, Kero uploads a video unboxing his new fursuit on June 22nd which is a few weeks later. And what a surprise! It looks just like the one in the chat.http://archive.is/CIZPs
>June 8th, 2017, telegram Kero mentions that he's going to Anthrocon in a few weeks.And a few weeks later…
http://archive.is/eoWuc"Raping animals is fine, but killing them? That's just too far."
>July 3rd, 2017.Kero decides to show some pics of what appears to be him in a hotel room.
Kero shows off his cool new body pillow.
>July 14th, 2017, SnakeThing posts a link to the now deleted(edited)
>July 14th, 2017, SnakeThing posts a link to the now deleted Shane Dawson interview, which was uploaded on July 6th.http://archive.is/cFrH2
>July 17th, 2017, Kero makes an alt telegram account. yamithewolf
>December 23rd, 2017, Kero goes to his parents' house for the holidays.https://twitter.com/KerotheWolf/status/944325641075347458http://archive.is/IekRz No. 696810
File: 1537913788650.png (84.07 KB, 489x295, 32-jpg.png)
Shane Dawson video mention
No. 696811
File: 1537913819722.png (188.98 KB, 520x539, 18-jpg.png)
Fursuit posted in telegram
No. 696812
File: 1537913852492.png (694.38 KB, 1264x781, 21-jpg.png)
Kero's YouTube video
No. 696815
File: 1537913889024.png (Spoiler Image,329.47 KB, 507x668, 35-jpg.png)
Degenerate images. Just fursuit poses.
No. 696816
File: 1537913928159.png (100.56 KB, 517x269, 3-jpg.png)
Rules
No. 696817
File: 1537913989182.png (354.08 KB, 593x574, 9-jpg.png)
Proof Kero gets off to vore
No. 696818
File: 1537914191399.png (199.74 KB, 1200x617, 3cb0542fbf8f4bfd0fde6661027d55…)
No. 696819
File: 1537914222039.png (209.69 KB, 1200x618, d0083e078c15983fcd475ef87f0f99…)
No. 696820
File: 1537914241492.png (219.15 KB, 1199x618, 44d8e3edbe95549535d607aaa0ec98…)
No. 696821
File: 1537914314377.png (42.35 KB, 505x90, 26-jpg.png)
No. 696822
File: 1537914347141.png (47.94 KB, 510x91, 17-jpg.png)
No. 696824
File: 1537914378087.png (39.1 KB, 506x100, 1-jpg.png)
No. 696829
File: 1537914831815.png (108.51 KB, 410x770, proxy-1.png)
Kero's boyfriend was also a dog fucker. Images censored.
No. 696831
File: 1537914909919.png (240.99 KB, 389x818, proxy-2.png)
No. 696840
File: 1537915824693.png (131.76 KB, 505x445, upload_2018-9-22_10-28-51-png-…)
Two other predominant figures seen in the logs. Snakething and woof.
No. 696843
File: 1537915895100.png (67.46 KB, 614x774, puppoo-png.png)
They also rape other people's dogs without their knowledge.
No. 696847
File: 1537916073308.png (37.72 KB, 698x406, fss-png.png)
No. 696848
File: 1537916167148.png (47.28 KB, 582x456, mutila-png.png)
In his spare time woof dismembers puppies and keeps their limbs as trophies
Oh he adopts innocent animals from shelters, just to kill them and rape them
No. 696850
File: 1537916402592.png (Spoiler Image,1.09 MB, 1268x548, woof.png)
Someone suggested this might be woof. SFW but spoiler because no one wants to see a sweaty disgusting guy. The snake is a banded watersnake apparently very prevalent around the North Carolina coastline.
No. 696851
File: 1537916408436.png (43.72 KB, 682x538, ils-png-1.png)
No. 696856
File: 1537917031268.jpg (1.72 MB, 2560x1920, 18-09-25-05-44-24-401_deco.jpg)
Any farmers by chance living in North Carolina recognize this shop? This can help us find Woof.
No. 696858
>>696850It would match logs where he suggests the others buy snakes and he also hinted having interest in boas.
His chrome or Firefox was in Spanish though and this dude looks white
No. 696865
A furry general would be pretty great. Kero is definitely not the only or worst sick fuck in the fandom. Does anyone know if he's friends with Sibe?
>>696816>>696840>>696848Wow that's sick. Hopefully the last one is just a fantasy.
>>696856Is bestality or production of bestiality illegal in NC? If so, there may be some sort of way to petition Youtube to send his contact info to police, assuming that his videos were monetized and they have his billing info.
No. 696875
File: 1537918268010.png (30.7 KB, 602x382, infection-png.png)
>>696868 Don't forget this guy. Another semi well known degenerate furfag, glowfox.
As a disclaimer all known furries can be posted here not just kero
No. 696876
File: 1537918308467.png (52.89 KB, 628x694, rim-png.png)
No. 696877
File: 1537918348132.png (87.92 KB, 551x917, untitled-png.png)
Desktop he posted
No. 696880
File: 1537918398520.png (382.94 KB, 1280x528, photo_238-jpg.png)
The image he posted had telegram and his YouTube channel open
No. 696882
File: 1537918540596.png (30 KB, 543x403, capture-png-1.png)
Glowfox is also a pedophile
No. 696883
File: 1537918640766.png (5.85 KB, 400x400, wut2.png)
what the fuck
No. 696887
File: 1537919057893.png (43 KB, 1026x244, screen-shot-2018-09-23-at-3-35…)
No. 696889
File: 1537919095054.png (112.78 KB, 1020x808, screen-shot-2018-09-23-at-8-16…)
No. 696890
File: 1537919118122.png (113.13 KB, 1024x884, screen-shot-2018-09-23-at-8-16…)
No. 696891
File: 1537919134326.png (238.37 KB, 500x281, Columbinego.png)
>mfw Eric and Dylan killed the wrong people
No. 696893
File: 1537919150950.png (142.43 KB, 1018x1218, screen-shot-2018-09-23-at-8-17…)
No. 696894
File: 1537919220133.jpg (57.79 KB, 818x541, flora.JPG)
>>696779I saw this on KF but don't post there. They were asking for plant ID to find Woof. Picture flora5 looks very much like Syngonium podophyllum which is a native of S.America.
https://www.rhs.org.uk/Plants/17899/i-Syngonium-podophyllum-i/Details No. 696895
File: 1537919359035.png (135.49 KB, 1014x992, screen-shot-2018-09-23-at-8-18…)
More depraved shit
No. 696896
File: 1537919390788.png (277.08 KB, 1600x1200, proxy-3.png)
No. 696897
File: 1537919431022.png (294.39 KB, 1600x1200, proxy-4.png)
Apparently cp is only acceptable when the children are abused enough to "enjoy it"
No. 696898
File: 1537919586757.png (Spoiler Image,1.34 MB, 795x1200, photo_279.png)
This may be snakething? Correct me if it's someone else
No. 696899
File: 1537919684436.png (837.86 KB, 1280x996, e6085a9752833ed0b0bcf371c20687…)
Snakething's fursona and other handle
No. 696903
>>696896>>696897"Virtuous/MAP" pedophiles do the same shit. People excuse them as "w-well they aren't touching da kidz" but they're still jerking off to child porn, how is that any better?
>>696893>it tasted like cheetos >x3Why
No. 696939
File: 1537923357851.jpg (28.82 KB, 768x560, 1411028840173.jpg)
the fucken person(or ppl?) who took the bullet and watched those fucked up vids for evidence and shit, i really feel for them. someone had to do it.
still not enough proof it was kero? just as metokur said, it still is proof that there are furries skull fuck dead animals, rape puppies, etc. not that it wasn't assumed there were ones that twisted but, i bet it's on a way larger scale then what anyone would want to believe.
No. 696970
>>696967theres a roadkill deer fucking video too
there was alot of fucked up videos and pictures, a lot
No. 696984
File: 1537927012546.jpg (1.1 MB, 1440x2007, Screenshot_20180925-174732.jpg)
Snakething was posting his sister's kids in the telegram chat. I hope this isn't against the rules.
No. 696988
File: 1537927762378.gif (1.94 MB, 245x215, help.gif)
This is an entire new world I stepped into like a warm pile of dogshit. How did these people get away with this for so long? Jesus fucking christ, the chat logs posted in this thread are traumatizing enough I couldn't even look at the images. Fucking furries.
No. 696997
>>696890they're all vile demented scumbags but snakething horrifies me… the way they write all cute with uwu emojie and give out
hugs while talking about disgusting acts is unnerving
No. 697016
File: 1537931416955.png (586.69 KB, 1207x602, Screenshot_2018-09-25-22-08-44…)
>>697010If you don't want to see the images, delete the image folders before looking at the HTML files accompaning them
No. 697054
>>696895What is "d'awwwww <3" about a 12 year old jerking off a 35 year old man? wtf
SnakeThing is a creepy bystander
No. 697069
File: 1537937304132.png (178.55 KB, 1790x1640, 7D52052A-6FB4-4E67-8B8C-11A7F9…)
Can someone describe these pics? I’m too scared to look.
No. 697077
File: 1537938125180.png (64.78 KB, 469x834, viddesc.PNG)
>>697069Someone made a thread describing all the videos:
https://twitter.com/BROAADCASTED/status/1042597103518838784 truly disgusting shit
No. 697083
>>697069It's much worse than
>>697076 describes. I went through the archives a few hours ago and i'm NOT looking again but here's what i remember. The various members of the chat group shared graphic photos that include shit like
>tying a puppy up, raping it with a stick, decapitating it, making the head fellate another dog>tying up a dog from craigslist, raping her, decapitating her, then cutting out her vagina (the entire organ) and using it like a flashlight. pics of it in rotting(?) stages too are provided >graphic anal and vaginal trauma to one dog (cut them "into one hole")>raping a dog with a large pointy wooden object which is shoved in around 1 foot deep in the dog and comes out covered in blood while dog squirms in painJust a few of the things these people were (maybe are still) actively doing.
All of these people need to be in prison for life. Or just rounded up and shot. They are unfit for human society. They are an extreme danger to animals and will likely progress to become extreme dangers to humans.
No. 697089
File: 1537938569184.jpeg (56.69 KB, 710x760, C75B7030-AFA9-4638-9A34-2DA905…)
>>697083fleshlight*. You know what I meant.
Jesus wept. If I hadn't already stopped believing there was a God, this would have done it for me
No. 697096
File: 1537939238258.jpg (305.04 KB, 981x884, f4bb15f28eb21b59e8b1c521f8cc02…)
>>697093not sure about anywhere about outside of the united states but this is pretty straightforward
No. 697107
File: 1537940709532.png (69.29 KB, 764x1103, sep1a.png)
//Sephius Rivendare//
Furaffinity - Sephius Rivendare
No. 697108
File: 1537940889203.png (3.41 MB, 1536x2048, CCC45D61-C9F0-4B9A-B1CF-28F5F0…)
Patrick Pauger is Sephius Rivendare, yeah. His shit is still wide open and easy to get a hold of. He’s a bow hunter and looks a bit like the guy that was thought to be Kero initially. Maybe it is, it’s tough to say because I’m not watching those vids, but it seems like it would be easy for a bow hunter to go after deer, I think that’s one of the files. He takes a ton of photos but rarely appears in them. He has a husky dog who looks to be abused in some way just from the photos of her and the way she’s held. Patrick/Sephius is the blond haired guy all the way to the right in this pic. I believe Keltus Wolf is his boyfriend. I have some but not all screencaps from this album if anyone wants them.
No. 697111
File: 1537941025838.png (55.49 KB, 705x856, seph2.png)
It actually seems like a good chunk of this stuff may not even be OC content for them. For example, I've seen a webm of the bound ducktaped raped dog on 4chan and snakething even comments that he "loves those" like he's seen them before too. So if it isn't sephius crushing those dogs heads it means that there are probably a dozen more people that are still getting away with this shit
No. 697114
File: 1537941293202.png (Spoiler Image,287.48 KB, 553x311, seph3.png)
His suit
No. 697117
File: 1537941482270.png (Spoiler Image,51.09 KB, 657x852, seph4.png)
snakething was always trying to collect a collection of beastshit. I'm trying to remain optimistic because he's been doxxed so hopefully he's got a dirty harddrive they can use to van the others
No. 697120
>>697083Rounded up and shot is good for me. This was some of the most upsetting shit I’ve ever read about and I hope all of them end up getting raped and then rotting to death in prison. They deserve the very worst that can be done to them. I’m worried they’ll never be punished, though, which makes me feel sick.
All I could do after reading this the day it dropped, was hug my dog. I sat with him for about an hour and a half just patting him and brushing him, he probably thought I was crazy. I fed him so many treats. Ugh, I’m starting to feel like crying again.
No. 697121
File: 1537941892445.jpg (19.97 KB, 520x390, 2JDHPr9.jpg)
This is the icecream shop woof mentioned and these are shots of it. notice the blue trays and the slight logo? Any of you recognize this?
No. 697122
File: 1537941907933.jpg (20.63 KB, 390x520, FWCgEsG.jpg)
No. 697128
File: 1537942114457.png (6.32 MB, 1536x2048, CC61E684-0E9F-4650-84A2-A6B822…)
This guy has chest tats that may be like the guy in the vid. Again, I don’t know because I refuse to watch. He’s a friend of Sephius.
No. 697129
File: 1537942219206.png (3.15 MB, 1536x2048, E6D5BFF9-37BF-4D43-9D47-B81464…)
A few more from Sephius’ group. Same guy.
No. 697130
File: 1537942238016.png (23.98 KB, 577x387, woof2.png)
I am getting chills now. They have no regard for anyone but themselves jesus fucking christ
No. 697131
File: 1537942399921.png (Spoiler Image,5.28 MB, 1536x2048, 390B23C0-BEDB-4223-81DA-9CB833…)
Michael Kupsa holding this husky in a creepy way that makes me uncomfortable, they do this in almost every picture with this dog. It’s sfw but spoilered for gross.
No. 697132
File: 1537942406086.png (26.32 KB, 507x348, woof3.png)
No. 697136
File: 1537942617961.png (38.13 KB, 643x551, woof4.png)
woof is probably the worst bunch of them all, offering to produce some of the worst shit
No. 697137
File: 1537942639255.png (4.31 MB, 1536x2048, E1CF81BE-D980-4C70-B796-3E179D…)
>>697133That’s Sephius’ friend Michael Kupsa. He does that a lot with this particular dog. She seems to get passed around, it’s upsetting. Pretty sure this is Sephius/Patrick’s boyfriend, again with the same husky.
No. 697140
File: 1537943052404.png (9.78 KB, 477x117, woof6.png)
They even pander to certain breeds and give them nicknames
No. 697141
File: 1537943210505.png (25.86 KB, 588x382, woof7.png)
No. 697142
File: 1537943218461.png (65.77 KB, 587x797, woof8.png)
No. 697147
>>697137reminder to archive this shit just in case they go on lockdown mode. archive something even if you're not 100% sure.
i use the archive.is bookmark since all it takes is one click and it'll do the job.
No. 697149
>>697010Curious what video Sephius is sharing that SnakeThing is suggesting he shouldn't spread. Is it any one of the previously mentioned ones?
It's been mentioned before but SnakeThing is such a fucking weirdo. The way he talks gives me shivers, like he's manipulating people into sending him more and more nasty shit with all his emoji hearts.
No. 697152
File: 1537944282039.png (40.17 KB, 690x599, woofface.png)
No. 697210
>>697157They should all kill themselves right this second.
But then again, they deserve an "eye for and eye" type of punishment too.
No. 697231
File: 1537952304245.png (83.1 KB, 824x818, f1.png)
snakething using his alt to defend a furfag rapist. He's in the purple, teal is anon who is trying to report the users content.
No. 697232
File: 1537952316698.png (53.22 KB, 607x690, f2.png)
No. 697233
File: 1537952324201.png (49.66 KB, 572x645, f3.png)
No. 697234
File: 1537952331565.png (65.43 KB, 746x874, f4].png)
No. 697236
File: 1537952413044.png (51.18 KB, 762x669, f5.png)
No. 697257
File: 1537955915521.jpg (10.96 KB, 275x183, images (1).jpg)
>>696856does this look like fucked up tres leches flan to anyone else? the bowl has remnants of what look like condensed milk/the liquid the cake soaks in. i've seen flan/tres leches combos before. if it is, this can help to narrow it down to a hispanic restaurant or bakery in NC.
his firefox was also in spanish, so him eating this would also make a fuckton of sense
>>697251i only see one cake/pie/whatever the fuck that monstrosity is. i'm fairly sure the top can be explained as flan and the bottom is the tres leches cake. it definitely appears to be it, unless it's some kind of fucked up lemon pie/cake. looks gross either way. hopefully we can find it. i've been checking the insides/tables/placemats for countless ice cream places in NC, and so far no such luck. the tables have some kind of marbled blue pattern on them.
No. 697271
>>697269They've been reported to the FBI a couple times now. Someone recorded a video of themselves turning in a USB stick with the data.
>>696856I'm being a big sperg here but I want to believe the placemats say Heladeria Himalaya.
No. 697274
File: 1537958802920.png (193.23 KB, 800x1186, Screenshot_2018-09-26-03-30-16…)
Kevin Patrick Perlstein / Colwyn Collie / Illone Sheppypaws / White Shepard / Niklo
Joshua / Kero's boyfriend who died of a drug overdose earlier this year.
A Kiwi found his Facebook account posted on his Fur Affinity page (see page 14 of the Kero thread).
The photos on this memorial site confirm the dox. They also reveal that he had expressed his proclivities starting at an early age.
https://www.forevermissed.com/kevin-perlstein/The website requires an invite to view, but by stopping the page loading I was able to capture the gallery thumbnails.
No. 697275
File: 1537958887231.png (602.79 KB, 800x1054, Screenshot_2018-09-26-03-28-56…)
>>697274I am posting these here because I do not see them posted on KF, and I do not have an account there.
No. 697277
File: 1537959086044.jpg (685.69 KB, 1439x1054, 18-09-26-05-50-20-580_deco.jpg)
Holy shit I found the place. Woof lives in Cuba.
No. 697284
File: 1537959547034.png (401.77 KB, 1436x789, Screenshot_2018-09-26-05-58-18…)
>>697281
Y118, 120, La Habana, Cuba is the address
No. 697288
File: 1537960036936.png (104.02 KB, 800x1173, Screenshot_2018-09-26-03-56-25…)
>>697278I managed to get a few captions to appear mid-page load.
No. 697291
File: 1537960335116.png (237.17 KB, 800x1176, Screenshot_2018-09-26-03-58-02…)
>>697289A few of his furry friends signed the guest book.
No. 697293
File: 1537960645709.png (302.78 KB, 800x1172, Screenshot_2018-09-26-03-59-03…)
>>697291Including Warg Schwarz aka Woof.
I don't see the surname "Schwarz" associated with Woof in the KF dox.
No. 697296
File: 1537960831592.jpg (30.23 KB, 500x400, 1528076478577.jpg)
yo what the fuck
No. 697301
>>697293>I will never forget the amazing times spent sharing the best of our time and what we had to offerThat's so disgusting when you're aware of what he means.
Good fucking riddance, I wish all of them would just drop dead
No. 697303
>>697288All of the captions can be extracted from the page source.
view-source:
https://www.forevermissed.com/kevin-perlstein/gallery/photos/I refrained from posting one cap which comprises photos of Kevin as a small child and of his resting place.
>>697293To clarify, I realize "Schwarz" is also pseudonymous ("black" in German).
No. 697317
>>697301Even more to the point
>sending stickers>>697304You'll have to read the threads like everyone else. A few new threads have been posted in the proving grounds and are awaiting approval.
Two Kiwis grepped a list of names mentioned in the logs and a list of names of participants in the logs, but I can't remember what pages of the thread they are on.
No. 697324
File: 1537965680936.png (297.09 KB, 800x1174, Screenshot_2018-09-26-05-38-22…)
>>697274
>You loved all kinds of animals, particularly dogs, more than anything in the world.Posted by his father.
https://www.forevermissed.com/kevin-perlstein/#stories No. 697333
>>697131HIS FUCKING FACE that's the face of someone who is a dog rapist and feels superior for having this depraved secret
i hope hell exists so they can all burn in it
No. 697371
>>697140On an logical level, I understand why vigilante justice is
problematic and why death penalty should be used to remove the toxic waste from the society but holy fuck.
On the emotional level I just want to destroy his and the other fucks face with a sledgehammer. How can soneone be such fucking disgusting, vile piece of shit and live with themself.
I want them to rot in solitary prison but I know this won't happen.
No. 697428
>>697397As much as I hate mob mentality and taking justice into your own hands.. for once I'm hoping someone does. If they don't off themselves first they'll go into hiding and try to run from authorities and what they've done now that they've been exposed.
They deserve whatever is going to happen to them.
No. 697439
>>697428I'm so scared they're going to get away with this.
In my country the police does not care much about animal abuse and the punishments are not very severe. It slowly changes but… well, slowly. I'm so used to sick fucks getting small fines or community service for murdering animals. I so so so hope this gets mainstream coverage and more people get outraged and those sadists will be properly chased down, caught and sentenced severely. How high are chances for that?
No. 697447
>>697131My heart breaks for that poor fucking dog.
This is the most horrifying thing I have ever read and I am terrified they will get away with it. I prefer lc to KF and just don't like the layout and shit of KF so I'm only keeping up with it here but… Jesus Christ how depressing
No. 697496
>>697439From what little I could stomach to see, it sounds like it's much more than just animal abuse. At least two of them discussed sex with kids and one of them provided evidence that he'd been doing inappropriate acts with his nephews.
I don't know how many of them were engaged in that but if the authorities won't do anything about the animal abuse they'll definitely get them for child abuse.
No. 697528
File: 1537983081517.jpg (17.03 KB, 330x452, black dynamite.JPG)
if furries are animals, does that mean we can hunt them all down?
WHERE IS BLACK DYNAMITE WHEN WE NEED HIM
No. 697638
File: 1537990734451.jpg (49.53 KB, 640x376, hellhound.jpg)
hellhounds will gorge on them in the after-life
No. 697733
>>696899You know that a furry is into particularly degenerate shit when their fursona has an animal cock rather than a human one.
>>696967>>697083Goddamn, people like this should be both fursecuted and executed. And the fact that the government (pretty much any given one) almost never lifts a finger towards abused animals or has any oversight on who's allowed to adopt pets is disgusting. These videos are shocking but don't even begin to represent the scope of the problem.
Sage for complete non-contribution.
No. 697943
>>697909>>697900Cuba has no animal welfare laws, though it's possible that it might be illegal for citizens to circumvent internet bans (i.e. what he's doing).
>>697937The FBI doesn't have jurisdiction over Cuba, anon. And they don't particularly care about animal abuse. If they do investigate this it will be out of the ordinary.
No. 697982
>>697965Do you doubt it, empirically? How many double blind studies have you run about furries who rape puppies to death? Have you know many?
Lol, get the fuck outta here.
No. 697988
>>697983Precisely.
Apparently this anon would like us to believe that in a country where homosexuality is considered an ‘invert’ from the doubleplusgood norm and is to this day punished with corrective rape by cops, that those same cops are just going to kick back about a fur fag degenerate like Woof?
Someone is throwing a lot of chum in the water and hoping for bites.
No. 697996
>>697985> They "euthanize" stray dogs with a poison that makes the dogs suffer more than the ones in the videos didBeing euthanized via poison or being raped to death by a huge, fire ant covered, sharp stake, having your vagina cut out, etc.
Uh, are you serious right now, anon?
>>697988>>697993Even in places where animals have little to no rights and are seen as property, it's pretty frowned upon to have sex with them. I imagine fucking and torturing puppies to the extent he did is even more frowned upon. This isn't some third world gambling ring dog fighting.
No. 698002
>>697996>>697993If bestiality and animal abuse are illegal, then there's really nothing the cops can even do but beat the shit out of him, but they'd have to put the effort into finding him first. That's just the reality of the situation. This is probably the worst case scenario in terms of bringing an animal abuser to justice; he can't even get doxed through usual means unless he mentioned his name and address somewhere at some point.
The best option in this case would be to somehow contact the Cuban equivalent of the FBI or secret police or whatever with all of the evidence and say that the guy was circumventing the internet ban to post videos of himself raping and killing animals. The Cuban media would also be a viable option, perhaps even a better one. Hell, if there's a public outcry then maybe some animal rights laws will get passed.
No. 698007
>>698002Chill. Woof will be doxed and when he is he will get fucked just like time rest of them.
>>698000Again, this. What do people think Cuba is? Jesus Christ, it’s not some shithole island hell ffs, my friends travel there all the time, both to help build the infrastructure and for fun. Of course they care about animal welfare there.
No. 698026
>>698007>Chill. I'm being realistic. This isn't the usual case where somebody gives little clues as to where they live over a period of years that you can trace back to a linkedin or dox-harvesting website. Unless the guy has incredibly poor internet hygiene then finding him is going to be an uphill battle for armchair detectives.
>>698024It would probably be the best course of action for finding him, in addition to making more Cubans aware of animal rights.
No. 698028
>>698024are they actually living in cuba tho? they don't seem very cuban and the pic where they are in austria there's a girl called julia LERCHBAUMER that sounds like a legit austrian last name idk they don't seem the type of people that would go live in cuba
i just want to see them in jail being raped with a knife, i literally just read one sentence of what they do and want to cry and kill them myself
No. 698031
>>697965The thing is, these guys aren't just kicking their puppies when they get on their nerves or something. They are violently physically and sexually abusing these animals. They're extreme sadists who get off on causing harm to living things. Even if you ignore the discussions of CSA and CP in their chats it's not a stretch at all to think they might eventually move on to harming people.
The link between violence against animals and violence against humans is very well documented, to the point that very few organizations refute it.
No. 698035
>>698028See
>>697159, hopefully it's not true, though.
If Woof/Warg is Cuban, the best hope for doxing him is that somebody in the furry community who's talked to him comes forward with personal info he's disclosed, or was part of a private chat where it was disclosed. Otherwise, the second-best hope is that he's a 'greymuzzle' who's been in the community for at least a decade or so and has a personal page floating around on archive.org. It might be a good idea to pull up some old furry directories and try to find someone who's from Cuba. Though even then it wouldn't be a good idea to take action without being sure that it's the right Cuban.
No. 698041
>>698028That’s Sephius.
Julia is Michael’s (the husky guy) girlfriend and she’s a furry too.
No. 698066
Can we have more people here willing to do work? Thanks.
>>698049You act like there aren't women who are dogfuckers and degenerates lol. lmao
>>698051Why would someone in Cuba with limited access be reading English forums?
>>698007How is Cuba not a shithole?
No. 698073
>>698069Looks like that could be his sister…
so incest?
No. 698118
>>697277Stop spreading misinformation, this isn't confirmed. this is merely THEORY.
There is literally NOTHING you can doxx woof over aside from a photoset he gave to snakething.
Stop spewing the shit said at kiwi because right now it's those white bois just discovering that flan is a latin american dish.
What we do know:
>uses firefox in spanish>bad english>white hairy arms (seen in decapitation pics) No. 698125
>>698124I didn't say he can't be cuban. I just posted about his appearance. Obviously latinos and hispanics can look white in complextion.
My point is, don't just say woof is in cuba because some kiwi said so. Even null had to whip their asses for doxxing randos.
There is little evidence about woof in the logs so for someone to magically claim he is absolutely in cuba is ridiculous. Most likely east coast but we can't confirm any location.
No. 698139
>>698134Are you fucking retarded? We confirmed the ice cream photos came from a place in Cuba.
>>697292>>697284>>697277We have a possible lead of some furry in Cuba who started deleting his shit a few hours after the ice cream shop was confirmed
No. 698150
File: 1538026675909.png (16.87 KB, 112x75, Screenshot_2018-09-27 La Helad…)
Sign for ref
No. 698153
File: 1538026740009.jpg (19.97 KB, 520x390, G6nfDWi.jpg)
Look at the top outline for the mountain logo. Same place
>>698134 No. 698159
File: 1538027018200.png (768.92 KB, 980x2108, Screenshot_2018-09-27-00-39-52…)
>>698144https://archive.fo/Nj11U#80% created 16 hours ago.
If you go to the actual site, the posts are gone
No. 698162
File: 1538027173609.png (73.71 KB, 694x383, animalgroupswoof ref.png)
Some things to look into:
>illone introduced snakething to woof
>hardzoo connection / collections also a producer
>woof is a mod of the “ADP group”
>ADP is also a website >mention of 8chan (8ch group?)https://73lgals6htl7akfm.onion.link/index.phphttps://73lgals6htl7akfm.onion.link No. 698163
File: 1538027190895.png (13.83 KB, 523x192, woofgrpups2.png)
No. 698170
>>698159>translationTrios for friendship and sex.
Hi, my friend and I are looking for a girl or 2 girls that are open minded to try new high level things. My friend is 18 years old, and I'm 28. We're both white caucasians, tall, wild spirited and open minded. There's no limits to our imaginations. Our limits are in mutual agreement… blah blah we're great people. We're simply into new ideas that aren't common in cuba. You guys can contact me at wolfschwarz39@gmail.com
No. 698172
File: 1538027787166.png (57.17 KB, 796x586, cuba.PNG)
looks like possibly woof's beastforum account. linked to the wolfschwarz39 gmail, says from Cuba.
http://archive.li/7yu87 No. 698175
File: 1538027976184.png (130.94 KB, 953x438, furry.PNG)
from his cubared profile. it says in his music he likes "snuff porn gore" is that a music genre? i'm not googling.
No. 698176
File: 1538028016133.jpg (260.86 KB, 948x1293, pinhead.jpg)
>>698172Godspeed the person who sat through the first zoo video he posted on there. The found his face and it matches up.
No. 698179
File: 1538028351343.png (432.18 KB, 1440x2141, warfwoof~01.png)
https://www.deviantart.com/schwarzweiler/Found his DeviantArt with military art. Interests line up with the other websites.
No. 698188
File: 1538028866241.jpg (304.22 KB, 1462x1554, ugly fuck.jpg)
No. 698189
File: 1538028885262.jpg (110.75 KB, 1429x1554, kill it with fire.jpg)
No. 698190
>second part of the post >>698159I would say that he which has or creates its own reality. Define as open mind, the ability of a person to reach a state of mind that, no matter how exotic can be the things you hear or see, they do not cause a negative reluctance, but rather be able to appreciate things in a neutral way. Usually when I talk about having open mind, it means that you don't have in your eyes bandages of any kind of nature that distort the way the information comes to you. What are bandages? There are many types, religious, political, social, cultural, etc… In short open-minded people are those who regardless of the nature of what they see or hear, are able to simply say "wow that is incredible", or "hey looks great," or "don't know if I would do, they would try to see me as I go", or simply "is not mine, but to each whats yours" instead of saying "You are some freaks mentally ill" or "Yuck" as said the majority. From what I have been able to appreciate, to achieve a mental state of this type, there is a need for a fundamental ingredient, which is the will. A powerful aim and desire to find things that break with all the standards and traditions that the majority know and be prepared to be inserted into other realities and put into practice new ideas. To these conclusions I have come,then to observe the reactions of different people here and there. Others may differ from my criteria.
>yes his spanish grammar is also retarded No. 698202
File: 1538029455912.png (444.35 KB, 1127x532, location.png)
ok so i found he's from San Miguel del Padron, La Habana, Cuba and is an IT person
No. 698205
>>698202Good searching anon!
I found this amigae website
http://archive.is/YmXOc No. 698213
>>698210I think it's mostly because they don't have his full name yet. But it'll be fucking easy since the military has the info.
The hospital shit lines up because he mentioned he drugged a dog with anesthesia. Only someone in the field would have access to that.
No. 698215
>>698213If he did work on a military base in cuba it was probably Almacen de Retaguardia. If he was a military contractor or a civilian he may have a staff pic if the hospital on base has a page. Most base hospitals have staff pages including like…janitors even. I just cant figure out translations enough to find an actual hospital.
None of his pictures have any rank or name tag, or awards so its likely that he is a civillian contractor.
Its possible any it work he mentioned befote could have been done on base. He has the posture and facial clench of both a military member and a huge fuckin piece of shit so, could go either way.
Semi tinfoil, semi half done research, semi armchair but fuck this guy so much.
No. 698222
>>698217At this point I am trying to go with this jump off point.
The base is called Almacen de Retaguardia. On this base there absolutely will be one (possibly 2) hospitals and those hospitals will have a website.
On the website there will USUALLY be a staff page or staff search function.
Im wondering if his last name isnt schwarz or whatever that email is.
If we can get to the hospital website or close to it it may help.
No. 698228
File: 1538031567069.jpg (31.42 KB, 425x425, tank thing.jpg)
is there some kind of military reserve or larp-y bullshit like ROTC in cuba?
No. 698230
>>698182>>698188>>698189>>698224Im not sure how helpful this part is but-
He is not wearing cuban military uniforms at all.
His uniform pics seem to be digi cami from the usmc which is really only like 5ish years old, but black boots of that material are generally worn by the us navy. As well as that stupid fucking hat. There was a short time the navy was wearing the digi cami a few years back, so his uniform, boots and pack in the hiking pic lead me to believe he may be in the us navy.
Why is this helpful? Cuz that mother fucker may not have to worry about cuban laws. You go overseas (even if you were local) as a dod memeber and you follow uncle sam.
Or he could be buying random bits of uniform from various fucking salvage places. (Wearing them as a civilian on a base would be hella looked down on if he wasnt dod though)
No. 698231
File: 1538032010229.jpg (32.86 KB, 425x425, friend.jpg)
>>698230him and some other guy
No. 698232
>>698230How did you guys get the first video he posted on beatforums? I'm trying to download it to search through stills but he might have removed it.
If anyone else has it can you post more face comparisons like
>>698176 No. 698234
>>698229IF he works or currently works with the military as an mri tech this is almost absolutely the hospital. It seems to be the only one outfitted with mri gear on base, the rest are like lil urgent care like places it appears.
It seems that on the hospital website they dont have access to staff pics which implys that most if not all people working there are active duty, verus civilian or contractor.
That sucks for us but also means he really probably is fucked when we figure him out.
No. 698235
File: 1538032409285.png (20.03 KB, 1641x138, help.png)
There's so many of these sick fucks where does this fucking end
No. 698237
>>698210Kiwis have a PM group to discuss Woof.
Please remember to ARCHIVE EVERYTHING and include the archive links in your comments.
No. 698240
>>698236>profile translation "I seek to know"
basically someone with similar tastes to form a team of two and perform riding activities, camping, hiking, exploring, having a nice time, do fun things. others…
I" define myself as"
a german Shepherd dog = ^. ^ = Faithful, with disposition for work and spirit of struggle.
"I like"
activities, hiking, Dinujar, reading, camping, Videeojuegos, dogs, exploration, survival, rappel, weapons/military equipment, video games, and movies. forests, nature. Interesting things. Musica mainly Wardruna, others…
No. 698241
File: 1538032748435.jpg (8.36 KB, 430x237, DeerFace.jpg)
From the deer video.
No. 698247
>>698241That's someone else. Alot of the videos these guys posted are content they circulate, I've even seen some of the pictures they posted before on 4chan.
Kero was using that random photo to prove his innocence kek
No. 698253
File: 1538033112385.png (32.44 KB, 420x416, mri.PNG)
the mri bit from his devoted singles acct
No. 698254
>>698243Not to my knowledge. I have been reading the threads since they started.
>>698247I got it from KF and posted it here for the anons who want to compare his face to the known furries without watching the video.
No. 698264
File: 1538034879492.jpg (16.53 KB, 320x360, 1535404210839.jpg)
This thread certainly outdid Soren's on Horrorcow status. Holy shit.
No. 698269
>>698264sorens narrative and pedo fantasizing is literally nothing compared to this fuckery, i still dont want to believe any of this can be real either
i can't even believe people are this sick and allowed to breathe
No. 698277
File: 1538036750988.png (221.08 KB, 887x803, woof.png)
>>698172https://archive.li/dOtdhholy shit, guys, good job finding him.
No. 698282
File: 1538037126535.png (447.38 KB, 2048x1122, Screenshot_20180927-172941.png)
>>698172This part of his little bio thing has me fucking hollering. You can violently sexually assault animals all you want but pwease don't kill the poor little wolfies~
No. 698287
File: 1538037530246.png (157.85 KB, 1599x776, dgen.png)
>>698282The rest of the website is just as bad
No. 698293
File: 1538038191714.png (68.45 KB, 1876x757, bwoof.png)
No. 698294
File: 1538038263264.png (85.17 KB, 1877x782, bw2.png)
No. 698296
File: 1538038463091.png (72.43 KB, 1067x818, bw3.png)
It just gets worse, note the changing number of dogs that he probably killed
No. 698297
File: 1538038488335.png (84.72 KB, 1858x796, bw4.png)
No. 698298
File: 1538038519757.png (114.09 KB, 1851x846, gw5.png)
No. 698299
File: 1538038530872.png (51.11 KB, 1154x709, gw7.png)
No. 698300
File: 1538038594281.gif (1.99 MB, 303x206, lkrwtf.gif)
>>698282how does this thought process work? how can you sit on minute going "dont hurt the animals" then turn around and go "oh man, stuff my dog full of dick today"
fuck i felt gross typing that, wtf?
good job anons seriously, find these fucks and take them down
No. 698301
File: 1538038729928.jpg (262.72 KB, 1473x437, fdsa.jpg)
>>698296yeah i noticed that too, jfc
No. 698305
File: 1538039061487.jpg (Spoiler Image,1.5 MB, 3200x1200, Untitled-1.jpg)
>>698303yeah you're prolly right
i censored the dog dick better uhhh
sorry in advance
(this is woof/wolfss btw)
No. 698307
File: 1538039164876.png (139.94 KB, 1840x589, gg4.png)
No. 698314
File: 1538039828485.png (13.93 KB, 682x159, gg=g5.png)
>>698313
His demeanor is different on this forum because they find themselves superior for being against cruelty lmao
Meaning they don't think it's moral to fuck puppies or reptiles and birds despite dog fucking being acceptable
Here woof mentions getting a new puppy
No. 698315
File: 1538039835876.jpg (408.51 KB, 1804x1393, www~01.jpg)
Woof's Rottweiler
No. 698316
File: 1538039864994.jpg (526.57 KB, 1847x2358, DSC07649~01.jpg)
>>698315Him and his German Shepherd
No. 698317
File: 1538039904770.jpg (410 KB, 1855x2415, IMG_20150802_072609~01.jpg)
>>698316These are from his G+ photos
No. 698319
File: 1538040138948.png (140.99 KB, 1144x758, gg6.png)
snake mention
No. 698322
File: 1538040221781.png (34.84 KB, 776x258, wolf.PNG)
he had or has a facebook profile and posted comments in these two facebook groups. i can't find them. anyone more tech savvy than me able to?
No. 698323
File: 1538040278536.png (217.98 KB, 1669x1054, gg7.png)
Anyone want to search this email?
https://www.beastforum.com/showuser-1767506.htmlThis is the profile that woof thanked in his video post
No. 698329
File: 1538041273520.png (22.64 KB, 1147x229, gg9.png)
His spelling
>coks
No. 698331
File: 1538041512384.png (11.5 KB, 842x161, gg10.png)
Seems like he just fanboys over germany since he wants to visit it so badly?
No. 698333
File: 1538041785159.png (109.59 KB, 923x427, ggbday.jpg.png)
We got a birthday on this guy
No. 698349
>>698334Good work, anon. You're a stronger person than I.
Is there anything we can cross-reference him on with those posts and the messages in the archives? Like, the timing of the dogs going missing, for example
Man, I remember reading the word sadonecrobeastiality on a forum once years ago and thinking it was a joke… What a world.
No. 698359
File: 1538045527744.jpeg (100.33 KB, 750x499, FF9ACAC2-F0A3-448E-BA88-E4774D…)
could the close friend snakething is talking about here wolf?? he mentions having a hard video with a rottie..
No. 698375
>>698350>>698350>>698349Woof shared a photo of him fisting a dog with rottweiler-like coloring (dog not fully visible, it's a closeup) with the caption "Finished the night with 4 fingers going in and out fast/hard lubed with hot chilly :p" so I'm pretty sure that picture is of his female rottweiler.
>>698315Then there's the one of the puppy's decapitated head being used to fellate a dog. What's visible of the alive dog's leg matches up to german shepard markings, so the dog involved in those photos is likely his male GC. Same for the photos of the removed genitals being used like a flesh light, I suspect his male GC is the live dog in those photos too.
>>698316I feel bad for all the dogs he's killed but I also feel really fucking bad for the dogs he owns. Hopefully they'll be taken away from
him when he's doxed but they're going to be permanently altered by this.
No. 698386
File: 1538049467042.jpg (75.52 KB, 1080x522, 20180924_190236.jpg)
>>698333In the leaked logs, woof refers to himself as a fox, and in this forum he has a "SDFRedfox" signature. Maybe that's one of his older user names.
No. 698402
Are the other sleuthing groups simultaneously uncovering the same data on Woof?
>>698169 is capped from the Telegram group; they appear to have already known some of what anons found.
No. 698405
File: 1538051738128.jpg (233.2 KB, 1280x1024, woofwolf.jpg)
>>698402Not really much at the moment, the telegram group is slowly giving info due to some zoophiles coming forward. We might have his full name. Woof posted this screenshot of his emails in 2017.
No. 698412
File: 1538052755213.jpg (14.42 KB, 519x141, IMG_20180925_164259_038.jpg)
Other furries listed by SnakeThing as being into RLC.
No. 698440
File: 1538054956024.jpg (28.22 KB, 545x219, 1326793874.jpg)
Seems like woof may have been in trouble for his degeneracy before?
http://archive.li/7yu87 No. 698529
File: 1538063760653.jpg (232.78 KB, 1280x1024, IMG_20180927_115404_826.jpg)
>>698405Another shot from his email with his full name
We got woof! Kinda.
No. 698550
I can't even read this thread. I started watching the video here
>>696800 and it gets so graphic around halfway through that I can't finish it. This is fucking disgusting and I feel sick. I think the entire rest of my week has been ruined. Hope this fucker gets caught and punished for abusing innocent animals.
No. 698552
>>698551it's the internet and even better
it's an anonymous image board full of women teaming to the brim with vitriol for sick-fucks like this
Like this would be left alone, I'm surprised this hasnt reached /b yet and they found and swatted everyone apart of the group yet
every anon in here is doing God's work and you deserve medals for this
No. 698578
>>698572he was giving a blowjob, to a dog.
Doesn't matter if he's part of the original group or not authorities and the public should be notified about this guy
No. 698588
>>698572well, the ulfr cubared account mentions liking 'snuff porn gore', but it was in the 'music' section. all of his backpacker dating, dating shit, all stuff including his face in it, is linked to the ulfr usernames/profiles. so again, the question is, was he admitting he's into snuff porn/gore and just put it in the wrong section of his likes, because that's a pretty fucking big indication that this is likely to be our guy, or is 'snuff porn gore' a genre of edgelord metal or something (again, i'm not googling)
No. 698591
>>698588heavy metal listener here.
Nope, not a genre of anything besides degenerate illegal porn, like that was hard to figure out
No. 698594
>>698588To be honest, I think we have a dox that is approaching reasonable doubt - if this were a Jury Trial, I think the evidence would compelling enough to get at least several jurors to say guilty.
But it's not a necessary logical connection. And that's what bothers me. Because I find that a less than necessary connection (even if everything seems very likely) can give room for refutation and even possibly oversight on our part.
If we just were to find a statement on one of Pernas' profiles stating that he's gone by or goes by Woof some place or a mention of some of his IDs by one of the zoosadist circle then I think we'd have something. The memorial page link is thus hot data for that very reason - but I think if we had something alongside that our case would be ironclad.
No. 698601
>>698551It's fairly easy to find somebody if they're not dedicated to being anonymous and you have enough time on your hands/a lot of people who have enough time on their hands. However, in this case it seems like the furries/dogfuckers who came forward really moved things along.
>>698594The fact that people in the zoo community leaked his full name and address makes this pretty cut-and-dry. They're not going to betray one of their own on a hunch, given that it might put them at risk.
No. 698625
>>698551I posted
>>697274 the memorial page. I was surprised that KF had not posted it since the photos substantiate their dox. Finding Woof's comment there was an unexpected bonus.
I searched for the names of the other furries who left comments on the memorial page and looked at their fursona profiles. They do not appear to be associated with the zoosadist crew.
No. 698630
File: 1538072359008.jpg (Spoiler Image,295.9 KB, 1920x1080, Screenshot_20180927-200608.jpg)
>>698626I am happy that Youtube is demonetizing these idiots who are pandering towards very young teens. How has this content ever been eligible for monetization at all??
No. 698638
>>698572The ice cream shop he posted pics of is located in Cuba, the email screenshots, you can see incoming emails calling him Wolf, Ulfr, and there's one from BeastForum. Also you can see how wolfschwarz39 Gmail inbox open in another tab.
The Cuba Red, Amigae, Backpacker.Dating, and Agregame profile his name is Ulfr and he lists he's from Havana, Cuba.
On his Cuba Red, DeviantArt, and BeastForum profile he gives out his email address wolfschwarz39@gmail.com.
On his Cuba Red he also mentions using Telegram to discuss conversations.
Going off the schwarzweiler name, Sheppypaws on Fur Affinity follows a user with the same name, he lists Celtic Rock as his favorite music genre which can also be seen in his CubaRed, DeviantArt, Amegae, and another website under the Ulfir name.
Searching the name Wolf Schwarz gives you a LinkedIn profile for a dog trainer in Cuba, his Google plus account with photos of his German Shepherds and Rottweiler, and a deactivated Facebook profile that posted in a Furry Cuba group.
No. 698644
>>698632First these are furries too. Kero is well known in the furry animation meme community. He is even friends with some of them.
Second they get demonetized at the same time when the scandal with Kero happened. It is all connected and a consequence of his actions.
I just pointed out that something positive is happening and YouTube is taking action against this community which show furries in sexual and gore content.
No. 698663
>>698626i'm surprised more isn't happening. this has the potential to break the furry community. imagine being part of something for half your life, and then finding out a good number of them fuck dead dogs. and when the info comes out, everyone fucking denies it, and the only people helping to stop this shit are the haters who've been saying it all along. it's so fucked. please kill me with fire, i had nightmares about this all night.
>>698650woof's earliest posts on beastforum were actually asking if you could get diseases from fucking animals. past a certain point of desensitization, you probably stop caring, i guess.
No. 698678
>>698636>>698644Guys im sorry but no, not every furry is a dog fucker
you have no idea how anti-sex some furries can be thanks to that literal stigma put over them
it's like saying everyone who watches anime is a pedo and into loli porn, thats a really stupid line of thought, no?
Either post proof that they are part of this circle of sick fucks or leave them be, just because they might be a popular furry doesnt mean they all fucked dogs with Kero
No. 698682
>>698677All of it relies on an inference to connect it to a conclusion. We have two spheres here - a comprehensive set of dox on Pernas, and the content on Woof. All we have to connect the two are:
- The set of evidence that he is correctly located, has the motive, and has the equipment/knowledge to be Woof (Cuban, dogfucker, technical profession, Telegram user)
- That a reference to Warg in the woof logs points towards one of Pernas' alts
The former set are necessary conditions for Pernas to be woof, but in of themselves do not prove it. They only make it probable that he is woof.
The latter is the sufficient evidence, that which takes us out of the realms of probability and common sense and shows a direct connection between the two.
The former is circumstantial because it requires an intermediary inference. The latter is what we need, and i'm not sure it's ironclad.
No. 698684
>>698681?? okay so again, if you're into anime you HAVE to be hardcore, draw and fap to lolis and pass that shit around with other people?
Furry is a sub-culture thats been around since the 60's and it wasnt based off dog fucking, it started from wearing animal costumes and comics, nothing else are you serious?
Not every furry is a dog-fucker, im sorry but it's true. There are sick fucks in every community and this is one group, not the entire community you autist, put the hate towards the people that are actually SHOWING they approve of this shit, not some edgy 20 something who draws gore for fun
Gore is more prevalent in anime anyway so I guess they all kill and fuck kids too right?
No. 698687
>>698678Ehh I didn't say all furries are dog fuckers. I just said that there is probably a connection between said drama and demonetization. Learn to read. I am
>>698644 btw
No. 698689
>>698683Not defending, I just find that line of thought so fucking stupid
We have people that are shown to actually abuse animals and you want to lump thw whole of them together because… I HATE THEM GRR
autistic, very fucking autistic, js
No. 698690
>>698684Go back to kiwi if you're going to sit here and try defending furries you absolute retard. That goes for loli fags too.
You're on bath salts if you think that the proportion if dog fuckers and furries is anywhere close to the pedos in the anime community
No. 698731
>>698689not to derail, sorry, but i've been a furry for like, way too long… i just have a problem with everyone hushing bad shit like this up. cause oh no, it might make them look bad. and so all the evil shit behind the scenes grows unchecked.
and the number of people defending kero. why can't the furries find these people in their own community and do something about it? why's it gotta be us doing the dirty work, y'know. all those people that knew about this and didn't say anything. i don't want to be part of a group that has any percentage of dogfuckers. kill them all with fire.
anyways….. has there been any news on kero?
No. 698740
I read through this thread yesterday and couldn't bring myself to look at the evidence folder compiled earlier. From yesterday's start to now, you guys have done a smashing job investigating and finding anything y'all could. Fucking hell..
>>698678The same can be said for any subculture, but the issue here is that there's proof that a group -not just one- of furries has done this disgusting shit in recent time and there's an even larger number of them defending them and getting up in arms about it. A few bad apples won't ruin a bunch, but if you let it sit and ignore it, the entire bunch will get worse with the same problem.
>>698644>>698630>>698626Part of this may very well hit harder on the response videos many will be making to defend people like Kero. Depending on how big this story gets (or if it reaches the mainstream level), no one in the community should be making money off the slightest mention of the case.
No. 698752
File: 1538078835052.png (Spoiler Image,202.84 KB, 1331x511, femrot.png)
>>698405If you see the closed wolfhome account you can see he referred to himself as ulfer there too. His female dog, I'm currently trying to see if there are photos he sent in his telegram logs.
No. 698754
File: 1538079017317.png (Spoiler Image,143.15 KB, 992x292, deadrot.png)
In his history he also mentions his males failing health, I concluded died since he stopped mentioning it later and said he only had 3 dogs left. But on telegram he posted a photo of a dead rot and I can't help but wonder if it was HIS dog.
Don't click on the spoiler if you dont want to see(Dead animal)
No. 698758
File: 1538079498542.png (20.86 KB, 1380x163, ggdogtrainer.png)
dog training mentions
No. 698759
File: 1538079518342.png (20.89 KB, 1342x230, ggtrainer2.png)
again he specifies that it's not his actual job
No. 698761
File: 1538079543940.png (30.94 KB, 1428x253, gglocations.png)
Some locations he mentions in his wildlife posts
No. 698762
File: 1538079603842.png (5.71 KB, 572x92, woofwork.png)
Those forum messages are from 2015, in the telegram logs he alludes to some IT shit at work. August 6th 2018
No. 698772
>>698727I wouldn't worry, furries are almost always the types of degenerate who display this shit actively. That's part of what makes them so hate-able.
Also to the people defending furries comparing them with anime fans, a more apt comparison is DDGL. If you genuinely believe there are adult babies or furries out there who don't get sexual gratification from it, I'm jealous of your naivete but you're deluded. It's a sex thing. It's always a sex thing.
>>698740> A few bad apples won't ruin a bunchIdk if you're esl or something but the idiom is both said and means the exact opposite of this anon. It's actually
>a few bad apples spoil the bunch. No. 698785
File: 1538082690547.jpg (65.46 KB, 450x800, SNUG BUNNY.jpg)
SnuggleBunny one of the members in the chat has been revealed to be the manager of The Flapper in Birmingham, United Kingdom. Callum Whyte. Note people in the chat have listed SnuggleBunny being into RLC, which means real life cub… In non furry terms that means children. A pedophile.
No. 698787
File: 1538082778035.jpg (67.61 KB, 754x960, 2eojSjI.jpg)
>>698785I remember that group name. Fuck man.
No. 698791
File: 1538082920349.png (23.75 KB, 790x251, retard.png)
How the fuck are people thinking this is still a hoax
No. 698796
File: 1538083386786.png (92.44 KB, 652x671, wtf.png)
Twitter is a shitshow
No. 698799
File: 1538083682985.png (380.27 KB, 1440x1119, Screenshot_2018-09-27-16-27-05…)
>>698796Lmao oh my fucking god e-roleplaying? Boy shut the fuck up
No. 698865
>>698754Oh my fucking god. That gave me chills.
His rapidly fluctuating number of dogs is so scary too.
No. 698892
>>698780The furry fandom is on a slippery slope since decades. It did started rather innocently until the sickos got progressively into it. Some in the fandom did tried to stop the degeneracy but without success (the so called "burned furs"; there is a video that explains it very well on youtube, called "Furries | Down the Rabbit Hole").
I hope this horror will be the wake-up call for the furries, and all fandoms actually. IMO there is a huge problem with the "accept anybody" culture in the fandoms, the way misfits are going to bound with and defend other misfits, whatever they do (= communitarianism). A lot of shit can go under warps and people not having enough step back, not getting that this is very real…
No. 698898
>>698849It's someone from this massive list of confirmed zoophiles:
http://www.furaffinity.net/journal/8890608/It'll take digging.
No. 698918
File: 1538090755319.png (12.12 KB, 616x112, adum.png)
>>698892Huh, look who's in the comments of that video.
No. 698922
>>698748i was up all night looking thru woof's shit and screencapping it, ok, i did not sleep well anon. i agree tho, anyone defending them and not helping to expose these sick fucks is literally enabling it to keep happening. honestly, a lot of furries look at the fandom really naively, like oh, cute animals, meanwhile it's being used by creeps as a front for fucking zoophilia. it's like a downward spiral of degeneracy. i know people that got vore fetishes just from being around the fandom too long.
>>698892it's always been like this, hahah. i feel you on the second point tho
>>698822repzilla announced he's doing a video on it, if anyone cares about him
No. 698934
>>698893here's the exact quote from kiwi, it is at the start of the spoiler summarising woof's archives
"Page 1
- Pictures from Tor that Woof had downloaded showing a tied up rottweiler with buttons sewn over its eyes he was fond of."
the dude seems to really "like" rottweilers
No. 698960
File: 1538093785379.png (40.44 KB, 1457x325, killmeandmakeitswiftplease.png)
>>698943eh? i see them going from 2009-2018.
No. 699117
>>698159
>Hi :3 me (28) and my friend (18) are looking for 1 or 2 girls w/ an open mind for sharing our taste, hobbys, and "high level" stuff.
>[…] I think it's funny hoe some people claim to be open minded but end up being like lil pups compared to me :3 looking for 1 or 2 girls w/ an open mind for sharing our taste, hobbys, and "high level" stuff.
>[…] I define having an open mind like nor caring the kind of thing you see or heard, you can just say: "that's awesome!", "that's so cool", "i don't know if i could do it, i'd have to try it first", "not my kinda thing but to each their own" Instead of saying "you are a deranged freak" or "yikes", like most people say.
>[…] It's simple, people just forget you can have your own society w/ your own rules, while living in the normal everyday society like everyone else. You just don't allow external society's laws and rules to impact into your own small society. You can make a society w/ 1 or more people. Some people call that a "group" or a "clan". I prefer to call it a herd. No. 699119
>>699117same fag, i saw someone elses translation but i tried to show exactly why i think this proves 100% not doubts that the doxx is right and this is woof. specially the "just like puppies compared to me" part.
he also mentions knowing "open minded" people just that they are not from cuba.
No. 699299
File: 1538128287687.png (Spoiler Image,227.17 KB, 800x1065, Screenshot_2018-09-28-02-46-00…)
>>698552I had been glued to the KF threads since they began and was this close to joining to post what I had found when I saw that this thread had just been posted. Thanks, OP.
>>698565And with 100% less sperging about fire ants and foliage.
>>698650A couple of transmissible bacterial and parasitic infections were named on KF. But the dogs could contract bacterial infections from their abusers. And the dogs could be a mode of transmission of human STIs between abusers if they are shared.
Case in point [pic related]. I looked up tundra2055 with whom Woof was exchanging files in
>>698405.
These freaks are literally raw dogging.
>>698882But for him to find pleasure in seeing that done to a dog of the same breed as his own…
>tfw Coraline is ruined by these aberrant perverts.>>698440Any leads on whether he was indeed alluding to having gotten caught? Was there a period during which he had no online presence?
No. 699457
>>698892>I hope this horror will be the wake-up call for the furries, and all fandoms actually. IMO there is a huge problem with the "accept anybody" culture in the fandoms, the way misfits are going to bound with and defend other misfits, whatever they do (= communitarianism). A lot of shit can go under warps and people not having enough step back, not getting that this is very real…This. While people are having petty fights over if a 25yo/18yo fantasy ship is pedophilia, this kind of shit is allowed to happen DAILY. It's not just limited to the furry fandom, actual fucking child grooming, abuse and other horrific things are going down in many other communities because everyone is allowed in. Gatekeeping needs to come back.
>>699064Yep. Furries have always been like this. And it's definitely not the first time stuff like this has blown up in their community. Ever since the olden times of early 2000's they've been screaming "not all furries" and sweeping all the sick animal rapists under the rug. You motherfuckers are hated because so many of you are involved in some messed up stuff and you refuse to acknowledge it.
No. 699595
File: 1538164495236.jpg (399.97 KB, 1080x1958, IMG_20180928_201932.jpg)
Woof supposedly sent someone in the Zoophilia Evidence telegram a message
No. 699597
File: 1538164563234.jpg (383.93 KB, 1080x1635, IMG_20180928_201945.jpg)
Motherfucker just doesn't wanna get locked up lmao
No. 699602
>>699595>>699597Awww, the poow thwing! He wegwets it naoo!
Don't lock him up, fuck him with a stick covered in fire ants.
No. 699613
>>699597Is he really trying to play the “I’ve changed” card when there are actual videos of him raping and brutally torturing the dogs he was supposed to be rescuing?
Yeah guys let’s celebrate, in exactly 3 days we made this guy change his whole outlook and attitude about life and living creatures! He surely won’t torture and abuse to sasiate his vile fetish again… I mean he only did it on video like 5 times!
Lock this guy up before he goes from animals to minors.
No. 699628
>>699597Murders and rapes multiple dogs, but suddenly apologizes when people find out his name and location.
Hmmmmmm……
Nah, get fucked.
No. 699840
>>699766I'm currently speaking thru another party to Woof. He is currently offline so time is of the essence at this time to come to a decision.
He wants to trade access to a darkweb network in exchange that no one bring any of his info to officials or anyone that could recognize him irl.
We have 2 options.
Take the access which could possibly lead us to exposing more sadists, possibly creators.
Or finally drop the doxx on Kiwi and wherever else is relevant. Someone spoke of taking it to the Embassy. Regardless, I personally think his info needs to be spread everywhere but need more input into this before giving him and answer.
No. 699850
>>699836Fuck you. Seriously fuck you.
1) Deepweb vegans getting in on this is only going to help matters. Why the fuck would you actively prevent more groups getting involved?
2) These are no "deepweb vegans" and its a group that is regularly serving jail time for what they do. Fuck you.
No. 699852
>>699840Who is this "we" you speak of?
His dox have been online for nearly 48 hours and likely disseminated to people many degrees from this site, KF, and the other investigative groups. He must be truly panicked to delusionally think he can scrub the internet of the evidence and be able bargain a deal with you by which everyone will be obligated to abide.
Also, depending on the jurisdiction, anyone who makes such a deal with him and helps him conceal his crimes could be criminally charged as an accessory.
No. 699853
>>699840I say it's better to work with what we have; you don't know what will this "access to a darkweb network" bring, maybe a pile of nothing. This isn't a worthy trade, we have more than enough on this fuck, he has to pay, period.
I hope he's shitting himself right now.
>>699852Now that I'm reading your post, you are right. This kinda sounds like playing detectives. Whatever group anon means, you're not the only one who's involved. His info is here. Man is doxxed. There's no it taking back. If your group won't do something with it, someone else will. And I genuinely wish good luck to everyone willing to bring him down
No. 699876
>>699840Drop the dox, at least. KF is missing a thread on him
Remember.. this is the man who found a pitbull, removed the nipples, focibly put some inside its anus and vagina, fed some to her, raped her, decapitated the dog and shoved its chopped tail up its vagina after.
…God… i feel sick just writing that. I need a shower. SnakeThing is already being investigated by the authorities and fbi so theres hope
No. 699882
>>699840>>699853Do the 2nd and get authorities/whoever involved as best as possible. Considering how much he's already crying about it, he may try to make some kind of deal and implicate himself and others further.
This guy deserves every bit that's coming to him.
Also no shit fucked up things happen on the darkweb. It's still fucked of course but I feel like authorities won't be as interested.
If the network was pedophilic (like legit CP or worse) in nature then I would feel differently.
>>699876holy fuck. why is this the first time ive heard of that in this thread? i have no words
No. 699883
>>699840Nothing to add but i agree with
>>699843 there shouldn't be no shame on fucking him over after having the info, if he's such a fool thinking he's still unknown then he must still be getting his info from kw so I guess that still leaves a room of time
No. 699886
>>699875Content has been shared between LC and KF, but LC hasn't been named on any of their zoosadist threads. But this thread is undoubtedly being watched by his friends.
And why would his contact be posting his offer here if Woof was not aware of this site?
>>699882What is he implying is on this darkweb network?
Ultimately "we" are not law enforcement, prosecutors, or judges.
And
>>699840 could be a ruse or a troll.
No. 699889
>>699840holy shit FUCK this guy
We can't dox people we find on the dark web. The point of it is that it's untraceable. The people there actually know how to hide their identities. This is a fucking trick.
put his dox on KF and get it over with
No. 699890
>>699886>What is he implying is on this darkweb network?Yeah I agree it is probably a troll now that I've given it some more consideration and the fact that all that post says is "access to a darkweb network" lol. Yeah, no thanks.
>>699889Agreed. Doxx
No. 699904
>>699902That's what I'm saying but he's most likely watching this thread.
Also if Cuban officials get him we can see if they'll extradite to US and get the info out of him anyways
No. 699910
>>699907OP here, I had a feeling not putting direct names in the subject would prove useful.
Is the group public or private atm?
No. 699977
>>699970Currently most of all we have is a user who created the Zoosadist evidence logs who will give out new info by request. I'm not sure why they don't just give it all out like the telegram logs.
Even with that, there's some older logs not archived.
No. 699980
This has all been a nauseating hellhole. And I don't mean to derail, however, in falling down this path I've discovered that there are even tumblr blogs dedicated to blacklisting furries (i.e., pedos, zoos, alt-right, terfs, etc).
Seeing how this also involves animal abuse, does anyone know about this group in particular?:
https://furry-fandom-jerks.tumblr.com/post/176799235079/warning-animal-abuse-this-is-a-group-of-fucked#notes No. 699994
>>699980Can you summarise what's in he post before leading us to click on it please?
Sidebar a-log: all furries should consider necking themselves. Even the 'not all furries!" furries.
No. 700001
>>699994Sorry. Quite new.
Basically linking out to a call-out blog. Post has screenshots of a RL Vore group. Claim is that members are known to/thought to feed live puppies/kittens to predators (e.g., snakes).
No. 700056
>>700040This. And why would we
want to negotiate with him knowing what he's done and encouraged and described?
Dude deserves the slow and painful.
No. 700326
>>700321how is any furfag even entertaining the idea of defending this guy.
why aren't they reveling in the chance to boot him out and make furries seem like NOT dogfuckers? Are they all dogfuckers?!
No. 700350
>>700321lel isn't that the same youtuber who did the video "in defense of pedophiles"
what a surprise…..
>>700326Yeah I also facepalmed when I read the comments on Kero's interview (posted above).
In a way it's not such a bad thing. As when the police will seriously get their hands on the case and the ring will go down, all these furfags and their reputation will be dragged down as well!
No. 700428
>>700422This post is making me feel better.
I'm so angry, and so ready for him to get exposed again.
Animal abusing pieces of shit need to suffer.
No. 700438
File: 1538254790246.jpeg (109.83 KB, 750x489, wehavevideo.jpeg)
>>700422you're not gonna grace us with the same images you posted on kf? post on kiwi said both images have something hidden. cant figure out the second one
No. 700469
>>700467he is the dumbest person alive. usual "locker talk" is about fucking and raping women right? and the people who engage in this locker talk discuss this (because they are gross men who enjoy the thought of feeling powerful over a woman but also) because they are attracted to women and have sexual thoughts about women!!
like it doesn't make anything better that it was "locker talk" you dumbass furfag
No. 700472
>>700465That'll just lead to people trying their hardest to prove it's not Koda and spread confusion, and then set a precedent of "#NotTheSameDog". In that time, Kero will have deleted everything and/or come up with another BS cover story. He has the chance to come out with the truth, but he has shown time and time again that he wants to lie. Don't give him a fair warning of what you have, just fucking blindside him.
Better to release the whole thing in one fell swoop, but also disseminate the screenshot publicly as a "preview" for those who will (inevitably) be too scared to watch it themselves.
No. 700474
File: 1538256641443.png (311.32 KB, 665x370, keroclinton.png)
No. 700528
File: 1538261113729.jpg (11.71 KB, 500x181, DoS8wwoVsAAJP-g.jpg)
https://twitter.com/GrizzlyFatalis/status/1046168566716747776click through to see defining features of Koda in the video Kero shared of him. Censored, of course.
No. 700548
File: 1538262907289.jpg (Spoiler Image,66.33 KB, 1280x721, photo_2018-09-29_14-36-53.jpg)
>>700535The video is graphic and will not be leaked onto Twitter as that would be against their rules. Will drop a censored image.
The video, as well as a possible other (mentioned in the chat logs), will be forwarded to the officers working with this investigation.
No. 700553
>>700548You can leak it to KiwiFarms and allow it to be added to the existing archive.
This video is the smoking gun.
No. 700592
>>700569good work.
>>700570see, he just didn't personally like gore, I guess it doesn't make his dick hard. he was all for the rest.
No. 700624
File: 1538269486891.jpg (59.65 KB, 480x619, wow.JPG)
Kero posted on twitter he was taking a break for his mental health.. and this is the kind of people that defend him. Yikes.
No. 700625
File: 1538269588302.jpg (18.94 KB, 292x326, b57.jpg)
>>700611What a fucking dumbass
No. 700630
>>700553>>700569The Kiwi claiming to be GrizzlyFatalis has already contacted Null.
And Kiwis were already aware of that Twitter account.
>>700604The sperging and new fagging was out of control, and he may have wanted the digging to take place in PMs so as not to tip off the biggest fish.
>>700611How can he not be aware of this thread? Enough furries are aware of LC. And, ya know, Google results.
No. 700660
>>700649
>begging videoWhat video?
>>700651They've taken the digging to PM.
No. 700662
File: 1538272979789.png (308.74 KB, 1096x643, CoreyTWC.png)
CoreyTWC has posted a confession.
No. 700666
>>700662"furries and drama go hand in hand"
torturing and raping puppies is not drama its utter depravity
No. 700705
>>700662tl;dr :
poor me, they deceived me and made me do things i would have never done by myself, blablabla not my fault blablabla they used me, blablabla
No. 700706
>>700689Fuck yeah!
SnakeThing should probably be reported to the authorities as well, if that's possible.
Is there any way we can help?
No. 700709
>>700474Kek anon! This was the first thing I thought of as well when saying that piss poor interview.
>>700565Really good video. Unfortunately it's such a small channel, I hope it gets traction.
No. 700718
>>700706Levi/snakething was reported days ago while the focus was on Kero, afaik. See
https://archive.fo/inTY2 and
https://archive.fo/eTk8n. I just hope it was done well enough.
No. 700764
>>700735Follow up: We will be releasing the 1 video we have of Koda once I send the email to the officer.
It's Kero filming the dog right after stimulating it. There is another video I'm currently trying to get a hold of that was spoken about in the logs from the one who has it. It might not be released to the public tho if getting it means it goes straight to the police. Just a heads up.
No. 700769
>>700689Damn did his mom reply?
I feel so bad for her but she deserves to know! Can't imagine what she must feel. Jesus Christ.
No. 700795
File: 1538294755117.jpg (Spoiler Image,66.65 KB, 1280x720, KodaVideo-Location of Joshua's…)
Left: Kero giving tour of his garage.
Right: Screengrab of Koda in garage from the video.
>Checkmate, motherfucker.
No. 700798
>>700796Let 'em.
Not my problem or anyone else who knows he's guilty.
No. 700805
>>700798Thing is the people who know he's guilty already know that.
This evidence - at least as presented - is somewhat contradictory. The paneling is the same type, but the colors are different (wood brown vs green and white).
I'm sure that a full video is a lot more conclusive than this, but I figured it's worth thinking about before this evidence is used to convince anyone whose head is buried in the sand despite the mountains of evidence that are less self-contradictory (at least at face value).
No. 700816
>>700662I really fucking wonder what he told his therapist. "Yeah, I'm involved with this group of people who get off of raping and torturing animals and I got caught and now I'm so upset :("
>I acted out of lustlust for WHAT? Do these people not realise that wanting to have sex with animals and being aroused by animals is a fucking problem?
No. 700836
>>700796Whoever says there is no sufficent evidence is clearly delusional from the star. Whoever defends this animal-fucker probably been trying to find any chance to defend him.
That paneling matching is no consequence.
Jesus Christ that poor animal.
Fucking sick piss bitch.
I am so disgusted. What a sick fuck.
No. 700875
>>700735Top stuff, anon. Thanks for your work.
>>700850>>700855It belongs with the police, not here on a public image board. Maybe the KF archive will need it for something, but best not ot public post it bc creeps will collect it.
No. 700879
>>700852I'm wondering this also.
>>700850Releasing the video should be an absolute last resort, if that, imo. Hopefully we see some justice.
No. 700953
>>700867That makes me so angry. If I had kids and I let them stay with my mom, I would expect her to protect them. If my mom was basically letting them get molested, she'd be fucking dead to me.
If Snakething gets nabbed for sexual assault on a minor, that fucking woman should be charged with failure to report a crime.
No. 700969
>>700953Sorry anon, I didn't mean to
trigger you.
It's just that if you know your son has cp, you should fucking report him and def keep the kids away from him. She hasn't reported him and has made some kind of bargain with him to behave himself, which of course he's defying. In the meantime, the kids are visiting and he's able to be alone with them. She has to be seriously in denial, and that's a dangerous position to be in.
No. 700984
File: 1538322896220.jpg (250.06 KB, 863x1280, orangeisthenewkero.jpg)
From the ZSIS chat
No. 700989
>>700852No, this was not about the Woof video, there was supposedly one other zooporn video that Kero made with his dog.
"There is another video I'm currently trying to get a hold of that was spoken about in the logs from the one who has it. "
No. 700999
>>700974>>700979It's his sister's children. she may not be aware of anything his mother knows, or the things he has said he did in the chatlogs about what he's done so far. it's extremely concerning if she doesn't yet know.
the kf thread on him is required reading tbh.
>>700978anon how do we know anything - he said so himself in the chatlogs.
>>700985denial.
No. 701004
>>700999oof- he admitted himself that his mom knows about his CP habit?
For some reason I feel like that's gotta be a lie to appear more edgy
No. 701017
File: 1538325954230.png (Spoiler Image,218.84 KB, 1068x1658, his-mother-knows.png)
>>701004chatlog cap from his kf thread attached. warning, creepy talk (there are no images).
No. 701022
File: 1538326138437.png (Spoiler Image,222.15 KB, 1024x1776, what-hes-doing.png)
>>701017another unpleasant excerpt. remember he's talking to a convicted child abuser. really the whole lot have to be seen to understand what this guy is doing.
No. 701043
>>701042sangie runs a business called inkfur or something like that, looking for his mugshot now.
I can't believe you guys didn't know this yet.
No. 701054
File: 1538329015830.png (45.55 KB, 585x616, convicted.png)
>>701043Inkedfur, I meant. described as "The furry print marketplace"
No. 701059
>>701043Honestly, I'd been looking at the KF threads but pacing myself on the chat log screens because it made me want to fucking puke.
Thanks for helping us put it all together. I was also confusing several of these key player's with others. There's so much its hard to keep it all straight.
No. 701063
>>700988Sources confirmed it is EliteKnight and was backed up with evidence.
Unsure of doxx status at this time. Either way, they've been reported to authorities.
No. 701065
>>701059I started in the individual threads because they were sickening enough but kind of … compartmentalised? chat log caps mostly
>>701063onya for this
No. 701072
>>701059levi running things, woof doing the worst, with the two of them knowing each other's real ids. the rest kind of circling around doing things to degrees that they are interested in. that's how I read it.
like with kero, he didn't want to see too much gore, kills his erection I guess, but he is all for rape and violence.
No. 701095
So did Koda end up dying from all of this?
>>701057He looks like Cotton from KoTH
>>701076Are there any updates in regards to police activity? And how does one join ZSIS at this point?
No. 701120
>>701095Koda passed away from kidney failure.
I've spoken with a close friend who is a vet tech and gave them an idea of the situation. Koda was a senior dog, that is very common during that age. However, if Kero drugged Koda at all, depending on what he used, it could have contributed. Short of Koda being examined, we cannot prove which scenario is likely.
As for police activity, an email with all evidence related to not only Kero, but SnakeThing as well, has been sent. I have also made clear the connection between the 2 and the officer informed me he will be calling North Bend PD to follow up and collaborate. I've sent photos, chat logs, address and anything related to Snake, all to the officer in case NBPD is lacking anything.
I'm fully dedicated to keeping in contact with them and keeping everyone updated.
No. 701127
>>701120good, thankyou
will you tell them about snakething and sangie also? or is that in what you've given them?
No. 701192
>>701072yeah levi/snakething would pretend to be into certain kinks depending on the person to get content out of them for his collection.
He agrees with kero on "muh animal abuse" but tells woof he's into hardzoo and with his kiddy buddies he engages in pedo talk
No. 701207
>>696779Sangie is in Austin, TX.
Also I’ve been banned from lolcow on my computer for the image of Kero/Koda with no spoiler image. Was my mistake.
Anymore updates will be posted by other ZSIS members. ✌
(ban evasion) No. 701245
>>701214Fucking bless you. Seriously. Reading what was done to those innocent animals, the thought of those people just carrying on to abuse more and more in their sick circle was soul crushing. Knowing people are trying to do something about it and hopefully destroy their lives is a blessing.
Nothing will help those animals and those freaks will unfortunately probably never suffer like the animals suffered, but exposing them and bringing attention to this kind of abuse is a huge help. Bless all of you.
No. 701255
>>701241>I don't like lolcow cultureThen why are you here
>This is valid>Validtumblr get out reeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeee
No. 701286
>>701274>I didn't expect to be a part of this because I'm not even a furry, I just happened to have a experience in datamining and was curious, only to find a very helpful part of information. Well that makes me appreciate your involvement even more. Reading this shit was heartbreaking, especially knowing that I wouldn't know how to help expose them, so the fact that there are people with that knowledge and ability brings a little bit of light to this.
Fuck them up and ruin their lives.
No. 701337
File: 1538351107583.png (98.4 KB, 750x1334, 8A58BA45-6DC6-4E8E-B6C9-45B259…)
>>701276To ease anyone’s minds about the police being in contact provided by @GrizzlyFatalis on twitter
No. 701361
File: 1538353584443.png (199.33 KB, 697x639, upload_2018-9-30_13-5-15.png)
>>700674>>700689>>700685>>700988>>701063CoreyTWC is not EliteKnight.
Corey was doxed on KF a week ago.
A newfag was banned last night for faildoxing CoreyTWC as EliteKnight.
This ZSIS member's continued insistence makes me skeptical of their other claims.
Anons, KF has a search engine. Use it.
No. 701367
File: 1538353847221.jpg (81.92 KB, 1280x532, IMG_20180930_202509_592.jpg)
Grizz's most recent email from officer indicating they has recieved the .rar of evidence and open to us providing further information if needed.
The .rar included not only information on kero but also snakething and various users they were speaking with.
We will continue to gather information on the other sadists to add to this file and contact local authorities as we are able.
No. 701372
>>701039>>701043>>701201Sangie was doxed and his mugshots posted a week ago on page 53.
Again, use the search engine.
No. 701525
>>701498>>701500>>701504No idea but it could have happened already. This has been out for many days.
>>701506His mother needs to catch some legal shit if she knew he was in possession of cp.
Let's face it, she raised this scumbag.
No. 701559
>>701506Not to mention endagering the welfare of a child by leaving him with a known pedophile. The police could absolutely charge her with that (or negligence perhaps) based on the cap of her sickfuck son tellung his sickfuck friend his mom knows he's a pedo.
And hey isn't it crazy how many hxc furries end up
also being pedos? Wtaf.
No. 701565
>>701482Do you know where you are?
>>701559Yeah I honestly hope he was lying about his mom, but… ugh. This would make her an accessory if true.
No. 701630
>>701361Please keep in mind that 'ZSIS' and anyone else dropping their hot details here are almost certainly the same angry autistic sped-tier furries from kiwi farms who were trying to dox people with ants and ice creams.
They got pushed into PM groups on KF because it's outright dangerous to let them continue to flail around accusing random people of being puppy-rapers in public, and judging from the quality of the doxes they've presented so far to our vetters it seems really unlikely any of their work is going to see the light of day, because they're idiots.
If they're going to insist on coming here and slipping you tidbits and teasing some kind of incredible happy ending where everyone gets caught and goes to jail, that's fine, but I would strongly suggest that you double-check anything they give you before accepting it, and don't get your hopes up too high for a good outcome because these people have proven time and time again that they're noisy, stupid, bad at doxing, and are so goddamn eager to nail the zoosadists that they have a reckless indifference to the fact that throwing out random people's names could literally end up getting them murdered.
All our love from KF <3
No. 701639
>>701633Because it's a good example of the kind of wild crowd-sourced mob-doxing that got five random completely unrelated people for every 'woof' you got.
It's not like they're accusing people of being harmless goofballs on the internet, here. This is some serious, heinously depraved sex crimes. Getting it wrong is serious business that could have serious consequences.
No. 701656
>>701630>>701639I know you're an edgy, jaded internet boi, but at least they're actually doing something, and their work HAS gleamed results. Woof has been caught and found, and Kero's video(s) of dog abuse have proven him a liar. No innocents have been murdered (lmao). I respect ZSIS more than some fence-sitting hecklers any day.
Let them talk about their work here and offer milk. You've chased them off your site, so what more do you want? What they're doing is more than you've accomplished up to this point, and this thread is more interesting than reading "OMG I am so disgusted" for 4 pages in the KF thread with
maybe a lead on who is who.
No. 701665
>>701659Look, we're all disgusted by this and we all want these degenerates caught. I'm not trying to shit on what they're doing. Except when what they're doing is doxing completely unrelated people like five times in a row and basically calling them puppy-rapers in front of the entire world. When that happens, yes, I am absolutely going to shit on what they're doing, because that's terrible and dangerous.
I'm not trying to be edgy and jaded here. I'm not trying to start any infighting. I came over here to let you all know that based off the PM chains and dox squads I'm seeing on kiwi, these people are on an accuracy-by-volume kick and they've already doxed the wrong people multiple times, and their attitude indicates that they will most probably continue to do so, so you should be extremely meticulous when you check their work because while some of it is clearly very good, the vast majority is scatterfire. For a board that usually doesn't allow dox, you're playing it extremely fast-and-loose with some heavy, heavy allegations. Be careful.
Also, puppies getting raped to death is 'milk'? Jesus.
No. 701666
>>701665I get what you're saying, but so far, all that's been posted here is progress from them as a group. We can call them out when they actually start fucking innocent people over and publicly, unabashedly smearing their names erroneously.
>Also, puppies getting raped to death is 'milk'? Jesus.No, necrophilic, sadistic rapists of puppies, adult dogs (and other animals) and human children getting exposed, scrambling and begging for the mercy they never showed their victims is. Keep up and stop jumping to insane conclusions, holy shit.
No. 701698
>>701675>>701684This is why I can't take drama forum posters seriously lol. Why the fuck are you namefagging on a Taiwanese bread baking s9te? Get over yourself. I swear, LC is the only "chan" site that has any semblance of traditional BBS etiquette.
Anyways, thoroughly enjoying all of the farmers autistic internet detective work and hard work here. This is like a more meaningful and moral HWNDU. Props to you all.
No. 701711
File: 1538401961797.png (16.52 KB, 645x111, furries1.png)
>>701684Sorry, let me explain. All the mass deletions and bans handed out on KF and the sudden unexplained moratorium on talking about woof were in direct response to bad doxes being dropped by the same group. All the people we 'chased off' kiwi were chased off for recklessly dropping bad dox. Scroll up and you'll see somebody already posted some caps from some random black kid being doxed as EliteKnight in this thread. That particular dox happened because somebody picked out a random account name subscribed to the targets youtube and somehow decided it was also him, and continued work from there.
https://i.imgur.com/MtOA9wI.pngAnother one was dropped because the victim had the same first name as the target and they were both furries, despite absolutely nothing else matching up. He had to sign up on kiwi farms and beg people to remove the pictures of him walking his dog and when we asked 'How do you know it's this guy' literally all they had was 'Well… they're both called Monty'.
https://i.imgur.com/qpzUDg2.pngThese are just a couple of the worst examples, there's a dozen or so more that got instantly nuked. This has been happening on KF for two weeks now. It's none of my business how you all run your house, but as your friendly neighbour I just popped in to say "Hey neighbour, be careful about letting those furries into your house, because they shat on our carpet and they'll probably shit on yours if you let them."
The work you've done on woof here looks pretty good to me. I'm not trying to put you down for it or downplay it at all. It's good work you're doing. But the retarded sting operation LARPing that's going on in some KF private message group full of furries is the part I'm warning you to be careful about and doublecheck any work they release, because they're the exact same people getting banned from kiwifarms for doxing random guys called 'Monty' and calling them dogfuckers.
No. 701732
>>701711Ok but this stuff hasn't been posted here, so why should we have to take it on board? This is KF business.
I personally crossposted many-days-old material from snakething's thread that, as far as I can tell, isn't in question. If that's misleading material then it should have been pulled from the relevant KF thread. So I doubt it's wrong.
The misleading dox is the anon/s mentioning EliteKnight's name (without proof to details to back it up). It's not exactly a big theme here.
>>701639But it isn't wrong, is it.
No. 701739
>>701630Yo' dude. You banned one of my accounts last week for the Ice Cream saga even though I wasn't doing any faildoxing or spaghetting in public (was just contacting possible joints to ask them if they recognised the bowls/table matts).
While there were lots of speds faildoxing and I'm glad the woof hunts has been driven underground (Null made a good call in ordering an embargo on the thread), the ban was unjustified - people did the exact same as I did and didn't get banned.
I wouldn't care less about this, except there are some conversations I was having on that account that I'd like to check for information/details at this point. So if you could have the decency to unban me, my username is:
kinglordsupreme19
No. 701740
>>701711>All the people we 'chased off' kiwi were chased off for recklessly dropping bad dox. Bullshit in my case.
>>701739Never dropped a single faildox on the thread or Farms.
No. 701752
>>701711The faildoxxing isn’t ZSIS. Our group isn’t dropping doxxes. We are only gathering and filing information on those from several sources (not just KF) and handing it over to the authorities. We’ve been doing our best keeping everyone updates and optimistic. We are working alongside the leakers of all this, KF users, Twitter users, etc.
AFAIK, only a couple of our people are actually KF members but most of or discoveries are being kept in TG and emails with the police. Sorry you feel this way about us, but do know that our group as well as others we are working with are wanting everything put into the hands of the law.
No. 701875
>>701849Also in a thread about movie critics someone posted screens of adam making posts about it
>>642454If there was a chance, the dude would gladly get fucked by an animal and it won't surprise me if he some involvement
No. 701883
>>701812It doesn't make a difference. It's not like they have the means to start a new life in Mauritius. And there's more than enough evidence to implicate them already. And given that these idiots are sharing their personal information and illegal pictures with each other, there is likely an even more extensive online trail for the FBI to find.
>>701822This is not a good look, anon. Being a sycophant is bad enough. Being a sycophant towards an internet person who isn't known for anything beyond attention whoring and "doxxing" people who share their personal info is just pathetic.
No. 701890
File: 1538422577890.jpeg (54.58 KB, 600x463, 741EA3EB-127A-4290-8FD5-6015C8…)
>>696856I made a post with this picture in the NC subreddit, bc I’m assuming they would recognized it, more than we would. I’ve been looking at ice cream and desert shops for days straight. Will post back if anyone recognizes it.
>>696840Shows fire ants. Which is mainly on the eastern side of NC (pic related)
No. 701950
>>701903
>weAnon posted
>>697277 on KF before posting it here. The same Kiwi posted
>>697293 on KF after I posted it here.
Users of each site are not mutually exclusive.
No. 701953
>>701923Not a Kiwi, only made a KF to keep updated on info.
Doing whatever I can to keep police informed and passing along whatever is found by multiple sources.
I want these people in jail and justice done. That’s all.
No. 701968
>>701824Love yourself, anon. Get a new friend.
>>701921I'm extremely skeptical of this claim. Why would you be in the loop on whether or not an arrest warrant was signed or police have enough evidence of a crime to detain/question a suspect?
No. 702011
>>701968Agreed on both remarks. Proof needed.
I know some anons weren't a fan of Dyn coming in, but I have to wonder if some are among the community he was describing. Regardless, the message was to remain skeptical and not take everything at face value, especially when it's just a text comment.
No. 702071
>>701968Agreed. Law enforcement doesn't release that info.
>>702011At least some of them are the same people. They came here insisting EliteKnight was CoreyTWC and that CoreyTWC had not been doxed even after
>>701361.
I followed the threads on KF and witnessed the faildoxing as it was happening. Now that those people have been banned they have come here to collect asspats for their cryptic claims.
>>701953Registered users of KF are referred to as Kiwis.
No. 702103
>>701656
>but at least they're actually doing something, and their work HAS gleamed results. Woof has been caught and foundBecause this board is anon, credit for the dox on Woof cannot be assigned or claimed.
Similarly, we cannot pin the specious claims made here on ZSIS, TG investigators, or the people banned from KF.
>and Kero's video(s) of dog abuse have proven him a liar.The video from which caps were posted does not show him abusing his dog, and the second video which was claimed to show abuse cannot be produced which casts doubt on whether it even exists.
But please, continue to let your dislike of KF and vitriol at the zoosadists cloud your judgment and blindly praise anons who make unsubstantiated claims.
No. 702168
>>702105No one said every and if I were to have any "hugbox" it would be this very site. I'm not even registered to KF and only skim the related threads when I am bored enough.
>I have to wonder if some are among the community he was describing>At least some of them are the same peopleSperging out because of these remarks is unnecessary.
No. 702227
>>701921Didn’t have time to clarify, was awaiting call from another PD.
They dispatched officers to pick 1 of the people up “J” because I was transferred straight to 911 after they heard what I was reporting. Not name dropping until I get contacted that they are in custody. I did however call dispatch back after 3 hours and they informed me that the officers were unable to make contact/nobody answered the door. I was able to track down 3 numbers that “J” could be using and am hoping for the best.
I was able to confirm however that Snake is not in custody in any of the jails (public record) and the officer leading his investigation will return my call within 2 days in regards to handing over more evidence. Feel free to call North Bend PD yourself. Officer Olsen/Olsan? is in charge of it. They also let me leave a message for the Seargant. Snake was also only reported for “suspicious activity” from what the female officer told me. I let her know the degree of what was going on and gave her my contact info and well as gave it to the sergeant.
I have also left a voicemail for Officer Zank working on Kero’s case about “J” being connected with both Snake and Kero. Trying to help them connect dots and put faces to who is who in the chats. I can provide proof if needed. Never used LC before this either so if proof posted, do I need a spoiler image?
No. 702229
File: 1538452948426.png (154.82 KB, 982x883, randomcuban.png)
Okay hi ladies, behind-the-scenes update on woof. A pack of idiots in a kiwi farms PM decided it would be a great idea to take their unconfirmed dox to the Cuban embassy and engage in what appears to be criminally actionable blackmail against a citizen of a hostile nation, while simultaneously posting on lolcow farm about how they're going to backstab him and release his info anyway ; despite his info already being posted in public here. We told them to cut their losses and prepare a dox thread with whatever they do have, and now members of their group are saying that they're pretty sure they didn't even get the right guy in the first place, and they suspect the person they trying to blackmail is just an internet troll fucking with them. That's the dox posted earlier in this thread, by the way. They're arguing now over whether or not it was ever any good, which is not a great thing to be arguing about when it's already out there and the real woof is either covering his tracks because they jizzed early or just sitting back laughing at how inept everyone chasing him it.
Earlier today we had to ban somebody for posting 4 wrong doxes in a row on the same target. Four wrong doxes, in a row, and no shits given. And right before that it was somebody claiming to have paid a substantial amount of money to an Arab Spring hacker to access Kero's accounts and data dump them. That's just the ones I personally saw today, and this has been going on for weeks. Our mods have lost count of how many stupid mad 'activists' they've banned for stupid, flailing, reckless doxing of random people over these leaks. And every single banned member gets redirected to Lolcow Farms because a couple of years ago Josh put a LCF link in the global ban message because he hates you.
To ZSIC or whatever, sorry for conflating you with this other group of idiots hunting woof and fucking it up. I thought you were the same people. I don't know what you're doing behind closed doors and I can only hope it's far less reckless and incompetent than the absolute shitshows we've been seeing so far, although I'm sure you'll forgive me for saying my confidence in everyone involved in this is pretty much flatlining at absolute zero now. If you prove me wrong I'll be delighted.
And to the LCF regulars, I know you hate it and get pissy when I namefag and ignore your board etiquette, I don't care. I'm sure I'll be banned and out of your hair soon, I'm just here trying to tell you, as one friendly neighbour to another, we've gone and done flooded your board with absolutely incompetent spergs and I'm sorry. So with absolute respect and humility, from myself to you, please please please please please, pretty please, pretty pretty pretty please with rainbows and sparkles and a big fucking pink ribbon around it, please stop being fat pissy stupid bitches and start taking an extremely critical eye to all dox dropped in the future relating to this. Please.
No. 702248
>>702229OT but this
>a couple of years ago Josh put a LCF link in the global ban messageexplains a lot of what’s wrong with this place lately tbh
No. 702257
>>702229ok, but in order for the dox to be fake/wrong, an increasingly unlikely amount of things would have to match up and happen to be insane coincidence or very deliberate doctoring, and at that point, it's just more likely to be the guy. you're telling me someone doctored photos to have wolfschwarz39 gmails, dropbox bullshit, wolfhome accounts linking to an account named 'ulfr'? so then, are these 'ulfr' accounts all incorrect, too? all of these old dating profiles that match up with a many years old beastforum account that matches a cuban wolfschwarz39@gmail.com from havana and the same exact dogs and photos from beastforum and dating accounts of a guy that is raping rotties and german shepherds that looks
just like the guy from the videos, that happens to live in cuba? a deviant art that mentions everything that the others do? all of these pieces coincide with each other. at the very least, there's an unhinged cuban puppy-raper running around, even if his name and address aren't the same, though i highly doubt it.
how could all of these conditions be met, realistically, without insane dedication to faking this? again, at the least, there's a genuine retarded cuban dog rapist running these accounts.
No. 702258
>>702021+1 though i feel bad saying it
people like this should be euthanized because they cannot be rehabilitated. look up the stats- they're grim. people this mentally/sexually fucked in the head cannot be cured or changed. their basic biological brain chemicals make them incompatible with society.
No. 702264
File: 1538455344041.jpeg (125.52 KB, 640x640, 9CCCA56D-D081-4C34-9F3F-5A28AA…)
>>702229> So with absolute respect and humility, from myself to you, please please please please please, pretty please, pretty pretty pretty please with rainbows and sparkles and a big fucking pink ribbon around it,fine. but only because you know what girls like.
No. 702266
File: 1538455457361.jpeg (Spoiler Image,604.87 KB, 2828x2828, 585C9E95-509D-4969-A484-1D5836…)
>>702235Again, it’s public record as far as Snake being arrested/jailed and that he was reported for “suspicious activity”.
1st call (2 minutes) was leaving my contact info.
2nd call (8 minutes) was asking his status and what info she was able to release to me.
Also attached an image of NBPD’s number as well as a screenshot of a video I recorded showing me pressing “Send” on the email that went to Zank containing both Kero evidence and Snake’s info.
Feel free to confirm and pass on any info you may have. I have no reason to lie. I just want them in jail and justice served.
No. 702288
>>702105By "faildoxers" I was referring to the newfags on KF who did just that and were banned for it. They tried to bring it here with the EliteKnight dox.
>>702116I am not a registered user of KF. I was the anon who found the memorial page and Woof's use of the name "Schwarz" and posted it here which makes me a member of the group you accuse me of being jealous of.
No. 702318
>>702229Again, this is Kiwifarms business being posted here for little to no reason. Can't you deal with this within your own community instead of venting about it on this board? We really don't care about the spergs you have to ban over there. We are not all part of your community userbase.
There have been no missions to do anything here, we're just talking. If you read the entire thread, you'd know we are not presently making a fuss about certain things, namely woof.
Yes we have that 'detective' anon dropping by to make comments, but they weren't asked to, and half the time no-one knows what the fuck they're talking about. They're not breaking any rules so w/e. Thanks for alerting us that they have some mistaken dox though - that is important to know. We're not witchhunting anyway, so no harm done.
If action on woof has been promised, and updates aren't being issued on how that action is progressing, some people are going to take it into their own hands - rightly or wrongly. So you have failed to control that on your end. If KF's private circle are wasting days talking to a troll … well I thought you guys knew better?
No. 702331
>>702303>>702303let's say that one photo posted by grizzly isn't woof (though we don't know that it isn't), again, at the very worst, an 'ulfr'/wolfschwarz39@gmail.com is really out there that looks like this:
>>698176 >>698182>>698188>>698189>>698316and is posting videos of him raping dogs all over bestiality forums. again, at the very, very least, this is the face of a cuban dog rapist that's infiltrating stray rescue groups, presumably to rape them - but he's at least, confirmed to be raping all of his own dogs. even if it isn't woof, it's not some rando innocent. may not be woof (though i highly suspect that it is) but the warg schwarz/schwarz/black wolf hint dropping is too coincidental. how many specifically german shepherd and rottweiler spanish-speaking (likely first language since his firefox was in spanish) dog rapists are there with shoddy second world internet that live near ice cream places that serve hispanic desserts with similar interior design/branding to Heladeria Himalaya, that also have an obsession with german black wolf phrasing/usernames? they can question it all they want, whatever, but there's still a cuban dog rapist with this face, into raping dogs, snuff porn, gore, that is a furry and is pretty fucking proud of his animal raping habit and is producing it for countless zoophiles.
what's even in question here: that one photo, or the screenshots, or what? as far as i'm concerned, just the photo not possibly not being woof doesn't seem to call any of the other evidence into question. the screenshots would have to be completely fake for that to be a possibility and doctored completely in mind with this other dog rapist who happens to have lived near that ice cream shop or just one with an uncannily similar branding/design that serves hispanic desserts, who happens to also have a wolf/german shepherd/rottweiler obsession, and a german 'black wolf' fixation.
No. 702336
File: 1538463856905.gif (3.68 MB, 452x308, giphy (1).gif)
>>702331Do you mean to tell me that people
accidentally found, doxed, and blackmailed a completely different, equally depraved murderous dogfucker?
No. 702350
>>702318
>some people are going to take it into their own hands - rightly or wrongly. So you have failed to control that on your end.If you recognize that people are going to take matters into their own hands, how can you expect KF to control them?
>If KF's private circle are wasting days talking to a troll … well I thought you guys knew better?It's primarily the newfags at KF who are faildoxing and negotiating with who they now think is a troll. When Null declared a moratorium on discussing Woof they took it to PM and came here. The dox posted here could have been posted by longtime anons, the newfags who migrated here from KF, or members of the Telegram group, but we will never know exactly who posted what. Many of the integral caps and dox were posted here with no verifiable source attribution.
It is our business now because the newfags have used LC (or at least used the dox posted here) to take matters into their own hands.
>>702331My question was concerned only with why he deleted his tweet. Alternately, perhaps he deleted it because the Telegram group decided to keep the discussion private.
Otherwise, for example, the caps of his emails containing his legal name were posted here with no verifiable attribution, only that "it was in one of the member's logs who was in the group chat that came forward."
No. 702358
>>702350>Many of the integral caps and dox were posted here with no verifiable source attribution.basically the only ones that were were posted without verifiable source attribution were the emails with the name. everything else, all of his profiles that link one username to another are readily available, and still online.
which, btw, here are some archived profiles i forgot to add when i posted caps days back because archive.is was being a bitch:
http://archive.is/acuWnhttp://archive.is/NTaiV
>Otherwise, for example, the caps of his emails containing his legal name were posted here with no verifiable attribution, only that "it was in one of the member's logs who was in the group chat that came forward."regardless, even if that exact name isn't woof, if that name is the gore and snuff-porn-loving puppyfucker pictured and profiled in this thread, he's no innocent. if it's just some rando's name/address, that'd be unfortunate, but i assume that anyone that was trying to get 'woof' caught also would've included photos/evidence? if none of the photos even matched his identity, i doubt it'd be taken seriously anyhow. the only issue would then be vigilantes or something. anyways, the emails were supposedly given by telegram creeps who had come forward and not the potential 'woof' troll, even, supposedly, right? so why would that be likely to be fake? i'm just trying to parse through what they're even trying to claim is fake, or what. at this point, all i'm seeing that's being said is that the 'woof' talking to the telegram group might be a troll.
>>702336>>702342i really think it to be unlikely after going down this guy's social media rabbithole, that he would just happen to be another spanish speaking black wolf obsessed rottie/german shepherd/big dog-targeting rapist furfag that lives by an ice cream shop that looks like the one woof goes to, gets off on distributing videos of him fucking the same exact kind of dogs woof does, that also just shares countless similarities with what we know about woof. 'ulfr'/wolfschwarz didn't post about murdering dogs on beastforum because it's a 'moral' community that shames zoosadism and apparently prides itself on only raping animals, not killing or torturing them otherwise, but he mentioned elsewhere that he liked snuff and gore. idk about the name and address and if it is ulfr/wolfschwarz's info, but everything on that guy's social media is legit and at least indicative of a shitstain nearly as perverse as woof.
No. 702363
>>702358This cap of his face
>>698176 was posted less than 4 minutes after an anon found his Beastforums account. How was the video downloaded, watched, and the cap posted that quickly? Ten minutes later
>>698232 asked and was never answered.
No. 702369
>>702358
>the emails were supposedly given by telegram creeps who had come forward and not the potential 'woof' troll, even, supposedly, right?An anon
>>701752 purporting to be from ZSIS said that "Our group isn’t dropping doxxes. We are only gathering and filing information on those from several sources (not just KF) and handing it over to the authorities … most of or discoveries are being kept in TG and emails with the police."
If that's true, why were they posted here?
Also note the timeline. The emails were posted here 6 hours after Grizzly's deleted tweet. On one hand, that was fast but not inconceivable. On the other, if he deleted the tweet because they decided to keep the dox private, why was it posted here?
>all i'm seeing that's being said is that the 'woof' talking to the telegram group might be a troll.Dyn said that it is the KF PM group which is not ZSIS.
No. 702373
>>702363his face is posted below too, from videos other anons downloaded.
>>698305i posted that beastforum account when i found it and when i archived it, it had already been archived, so other people, maybe the telegram group or the kf pm group, had found it, and had maybe circulated the picture to the anon that posted it. the beastforum profile and the DA account had already been archived, but the others (his 4 dating accounts and his google plus) hadn't been, so people were probably busy going through the beastforum account for vids/pics before it was even posted here, but even so, other anons went through the bf account hours later and saw and posted him sucking off his dogs, and from what was posted, his face matched his dating profiles, though i didn't watch them myself.
>>702369>On the other, if he deleted the tweet because they decided to keep the dox private, why was it posted here? the guy allegedly from ZSIS also said people have been coming in to lurk and sperg, so it couldve been a lurker. i dunno.
No. 702376
>>702370>>702373Thanks for the timeline from your perspective.
At the time I asked
>>698402 "Are the other sleuthing groups simultaneously uncovering the same data on Woof?" and the response I got was the first email cap and "Not really much at the moment".
When the emails were posted I did some digging into what else was visible such as the files he received from tundra2055. I found evidence of tundra2055 and another BF member circulating videos of themselves sexually abusing tundra2055's dogs.
No. 702400
>>702257>>702331>>702358I just caught up with the main thread on KF and on page 89 Dyn said, "While I've skimmed the dox and am inclined to believe it's correct, there is literally nothing concrete tying 'woof' to it besides a cuban tablecloth and an offhanded mention that he used to go by 'warg'…"
The comment posted on the memorial page
>>697293 mentions "sending stickers" which points to the author having communicated with Patrick / Illone on Telegram. Is anyone else who was a close friend of Patrick's on Telegram known to go by "Warg" or "Schwarz"?
No. 702410
>>702386When Dyn namefagged here in the KF thread, anons were begging him for dirt on other Kiwis. Now that he is here to issue a thoughtful warning to be careful and to apologize for the influx of newfags, anons rebuke him.
Before he posted here I was already highly skeptical of some of the newfags and their claims and actions, eg. EliteKnight, their belief that Woof doesn't know about this thread, negotiating with Woof.
No. 702414
>>702331I agree with you. I have no idea what "faildox" related to Woof were posted here according to that sperg Dynastia. Tinfoiling, but to me, it's been looking like this idiot is trying to derail the thread and mislead it on purpose the whole time, even though he claims otherwise (and that's he such a "friendly neighbour", even though he doesn't give a shit about the rules here… ok, such a great neighbour, truly).
Btw. let's remember what Admin posted here:
>>702125We shouldn't even be discussing this guy right now. Of course that autist Dynastia totally ignores that message and rushes here with the Woof info shortly after Admin posts this. What a "coincidence". Not only he doesn't care about the rules, but he doesn't seem to care about the the issue as a whole if he behaves like this.
No. 702422
>>702410Well, something seems to be going on with Woof, see the Admin's warning.
I don't visit the KF thread here, don't know who Dynastia is and frankly don't care. Not going to kiss his ass just because he's an admin on some other forum. He didn't exactly leave a good first impression, so say the least, and it's making me doubt the quality of "work" he does on his own forum if he's behaving like such an arrogant jackass here.
No. 702423
>>702410>thoughtful warningHe is attention-whoring, bringing unnecessary, meaningless KF drama to us and breaking rules. No one asked for him to namefag in this thread, as it is
not the KF thread. For someone just giving us a ~*thoughtful warning uwuw*~, he admits to not caring about the integrity of this site and its rules. Hmm. Maybe he just wants to look like an authority in all this shit that doesn't concern him.
He is possibly jealous and upset that his bans don't extend to other sites, and clearly did all this in a bid to derail.
This thread was going fine before he showed up, no innocents have been "murdered" (even though he'd like to believe otherwise), we haven't had a sudden influx of obnoxious, retarded newfags ITT, and no faildoxing has happened.
Simply put, his posts in this particular thread are worthless, and a ban is warranted for namefagging, derailing and discussing Woof even after the admin said to stop for now.
No. 702426
>>702229You know you're making the entire situation worse for both KF and LCF, right? The LCF admin deleted the posts from the leakers in that PM chain to stop the operation from being fail, but you decided to plaster them around KF and further advertise/stir drama up here and there.
All you're doing is a) spreading rumours and hearsay about the dox based off, and b) making it even easier for woof to discover a fuckup. But do you care? Nah. You want cool kid points and to look like an internet tough guy and gatekeeper.
tard
No. 702431
>>702414See
>>702400.
>>702423This thread has a huge influx of not just newfags but newfags who repeatedly faildoxed on KF. These same newfags attempted to faildox CoreyTWC as EliteKnight here. They discussed negotiating with (extorting) Woof in violation of the rule prohibiting cowtipping. Many of the caps and the dox violate the rule prohibiting doxing. If the rules are your primary concern, why are you not calling for them to be banned? If their targets are indeed incorrectly identified, how would their behavior reflect on (and potentially affect) this site?
No. 702437
>>702303>>702272This
>>702331 is spot-on. The histronic KF namefag is trying to insert himself because he can't handle not being involved in an attention-gaining measure and is jealous that a group of people doxxed somebody who is MUCH more difficult to find than average, given where the guy lives. Unless somebody doctored all of that info, which isn't the case given the presence of archives, at worse a different Cuban zoosadist was doxxed. Oh the horror.
At this point it's honestly probably best to ignore him and the other people from KF. They seem to be trying to make this all about them when they're virtually irrelevant here.
No. 702439
>>702432See
>>701361.
Search KF for EliteKnight. His name only appears in a list of usernames grepped from the logs.
No. 702440
>>702431Since this is an anonymous website, there is no way to verify who is who, or which users have done what. Even Dyn admitted to banning people on his own site who did nothing wrong, on grounds of "faildoxing" they never did. I don't know why he thinks his clearly haphazard judgment would be valuable here, or why he felt entitled to making himself the center of attention this way.
>If the rules are your primary concern, why are you not calling for them to be banned? I'm convinced the doxxing and cowtipping rules were instated because most of our cows and flakes are innocent, but embarrassing or annoying. Dumping their personal information or contacting them not only scares them off, the site can get in trouble (unless the target is an actual criminal, in which case, they obviously wouldn't want the police looking into the threads and allegations made therein). In this case, those involved are dog rapists, animal torturers, confirmed child molesters and other law-breakers. This is people committing crimes being identified and reported to the police, so the circumstances are obviously different.
Meanwhile, admins of drama sites who are only here to namefag, spread drama from their in-group and pretend to be authorities on something that has little to do with them? Especially ones who outright admit they give no fucks? Not so much. What great deed has Dynastia contributed here to justify any of his behavior?
>If their targets are indeed incorrectly identified, how would their behavior reflect on (and potentially affect) this site?That hasn't happened, and so far, we have no reason to believe it has or will. All we have is some attention seeker who openly says he doesn't care about this site making claims and dumping screencaps that prove nothing. He's successfully derailed the thread, as was his plan all this time.
No. 702444
>>702439Why would a group of people who are mostly non-affiliated with KF care about what KF is saying about people from KF?
>>702441It doesn't, they're just dragging their own drama here. Not sure why it's been allowed. This is an especially disgusting attention-grab/attempt to muddy the waters given the topic and how well the doxxing group is apparently doing at working with the authorities.
No. 702468
>>702437The actual dox (the emails) were posted by someone from ZSIS, not a regular anon, and were probably posted here only because they were not allowed on KF. The ice cream shop dox was posted to KF before it was posted here. The same Kiwi reposted my screencap of "Warg Schwarz" on KF with credit to /snow/ because I don't have an account there, but Dyn appears to have ignored it (or at least downplayed it) as a significant link.
>>702441Which part of my comment?
>>702444Because the newfags tried to bring their faildoxing here. When they stated that CoreyTWC was EliteKnight I replied several times that he wasn't long before the screencap in
>>701361.
And don't forget that anons were instructing the newfag
>>700528 who posted the link to Grizzly's tweet with the cap from the video of Kero's dog to give it to KF and Null when a user purporting to be Grizzly had already been posting on KF and in contact with Null.
If you were not closely following the thread on KF you missed the faildoxing which was rampant and embarrassingly amateur. When Null declared a moratorium on discussing Woof I worried that those newfags would bring their ineptitude here.
>>702457I was the only anon repeatedly correcting the misinformation. They insisted they had proof
>>701063 but did not post it anywhere and were ignorant of the dox for CoreyTWC already posted a week before. If those were not the dox they reported to police, then whom did they name? Reporting an innocent person is a big whoop.
The links to his dox are posted on page 66.
No. 702475
>>702303That was my mistake. Was posted before I was apart of KF and didn’t even know about LC. ZSIS wasn’t aware of the PM thread. If we would have known to not drop his doxx, then that would have never been posted. I will own that.
We were assured that was in fact the man we were looking for, by another party who said they did know him and didn’t realize we didn’t even have pictures. Since the PM thread was brought up, ZSIS has turned away from Woof and let KF take care of it. Once we realized he was in Cuba (when that tweet dropped), we turned our attention stateside since he was out of our reach and KF said they had it handled.
No. 702482
>>702408I was personally pissed off by that as well.
This was the first time I made contact with NBPD. I kept wondering if anyone really had reported him for what his crimes were and sadly my fears were realized when the officer told me he was not reported for anything other than suspicious activity, which is why I left my contact and want to inform them ASAP. The officer handling his case won’t be back til tomorrow I believe.
No. 702499
>>702475So you are Grizzly?
Regardless of what ZSIS decided, an anon or anons continued to post caps and the email dox they claimed originated with ZSIS.
No. 702513
>>702499I believe it was members who were in the group before admins decided to make it private and boot people for spectating, lurking, spergging, etc. I personally felt it should have been private all along but I did not create the TG group.
Someone did post a bunch of pages related
to Woof in the TG group but I’m gonna stop there since Admin said no more. Again, I’m just the contact with police to make sure everything is handed over to the right authorities.
No. 702549
>>702526No, that was not the only case. I saw two other people erroneously doxed in the thread. Both their legal names and pictures were posted, and the home address of one was posted. The latter joined KF to respond that he was not the person they were looking for, that he was harassed as a result, and to ask that his dox be removed. The thread was locked, his dox removed, and the faildoxers reprimanded. I believe one of his posts remains in the thread.
>>702513>>702529So you are Grizzly? I just want to confirm that I am reading
>>702475 correctly and that you are referring to the tweet.
No. 702552
>>702549> I saw two other people erroneously doxed in the thread. Anon is talking about
this thread. If kiwifarms is having a faildox problem, okay, whatever, but it hasn't seemed to really bleed into our thread is what anon is saying.
No. 702560
>>702468CoreyTWC IS ELITEKNIGHT.
I just confirmed with one of the teams who have been in direct contact with him and he has posted a journal confessing his involvement. His fursuit was also among the leak which was featured in one of the videos of him abusing his dog. He has also removed several submissions on E621. He was linked by name via paypal address when he commissioned an artist.
No. 702561
>>702552Apologies for misreading.
But they went beyond merely claiming that EliteKnight is CoreyTWC. They posted that they reported him to the police
>>701063. If they were ignorant of the dox for CoreyTWC that was posted a week before, then they reported someone innocent.
>Unsure of doxx status at this time. Either way, they've been reported to authorities. No. 702567
>>702560His journal entry was posted
>>700662.
I can't tell from the unspecific pronouns in your comment how CoreyTWC was proven to be EliteKnight. Whose fursuit? Submissions written under which name? Which name was linked via Paypal?
And this is an image board. Please post caps.
No. 702606
>>702526Obviously you hadn't read the 89+ page KF thread, but the faildoxing was rampart. They wrongly doxed several people (I personally saw 6, and when I went back, there were a lot of posts deleted). I don't care about Dyn, but his warning didn't seem malicious.
>>702567They linked his fursuit head from one of the videos to the Corey username, if I recall correctly. I'd have to go through the entire shithole of a thread to find the exact posts.
No. 702622
>>702606The main dox post is on page 46. The links on page 66 are additional dox.
Searching for EliteKnight only returns his name in a list of usernames grepped from the logs.
No. 702677
File: 1538505275559.jpeg (Spoiler Image,833.98 KB, 3265x2449, 626B49AB-AFD1-47FC-815A-1F5BAF…)
>>702584Yes.
Going straight to the police.
Proof image attached.
Matched the deleted account to EK’s TG ID.
Also shows him posting in the group his FA page to show his artwork as well as mentioning his handle in a seperate group.
Video of him in suit was given to police by a different source. I plan on making contact as well to send more.
No. 702948
File: 1538532287549.jpg (405.13 KB, 1080x1284, e373633e-a749-44fe-bc6e-1f46cf…)
Someone posted this person in another thread but I think she maybe belongs better here? This woman's Tumblr is sheilastretch. She's a dog fucker and got a dog specifically for fucking. She got tattoos to mark her as a dog fucker. She's delusional enough to that she thinks anyone who sees them knows what they mean and that turns her on. She has a Tumblr, a twitter, a reddit, and a website called legit kink.(net) She has rebligged furry art before but not sure if she is a furry. She has an account on a beast forum. Her husband encourages it and may be the mastermind behind what she does. What can be done about her? Someone needs to save her poor dog.(new)
No. 702953
>>7029064 people are being investigated, that’s the extent of my knowledge at the time.
ZSIS isn’t splitting, I just will no longer be apart of it due to personal decisions. I’ll most likely go on my own with the contacts I’ve made and update on Twitter.
(derailing) No. 703082
I just want to make crystal clear since there seems to be so much of it, but anyone who thinks these people are being protected cause “furries all want to have sex with their dogs”……get THE FUCK back. I’ve been working my ass off since the drop to make sure these fuckers ARE getting doxxed, reported, exposed, the whole 9. I’ve fucking lost sleep over this!! Other furries are doing the same. We DONT want them in the community. That’s why so many jumped into this.
WE HAVE 4 PDs INVOLVED RIGHT NOW. I have concentrated most of my efforts toward Snake/Levi and dropped heavily about him and his fucked up friend to the police about everything to do with those kids! I’m not sitting on my hands idle and waiting for shit to happen. I’m making sure it IS happening. I’m doing my fucking best to keep the public updated to show that progress is being made. But if everyone from literally every corner of the internet is gonna whine and bitch about every single small detail, then fuck it. Idgaf about furry image, a lot of the fandom is severely messed up, but just know that it is in fact furries, non-furs, zoos and other people from different walks that are coming together trying to make sure these people are locked up. This wouldn’t even be happening if the zoos who leaked this just decided to brush it off and say “not my problem”. I am fully dedicated to passing along info that is within my knowledge to give. But a lot of things have happened behind the scenes that hasn’t been said about.
As for KF: Not our circus, not our monkeys. They’ve been doing their own thing since day 1. ZSIS has tried to work with literally everyone on this in order to speed up progress of getting these monsters into cuffs. I’ve posted proof, I’ve posted updates. So I ask LC anons, what are you wanting said or done here?????(USER HAS BEEN PUT OUT TO PASTURE)
No. 703094
>>702363>>698305 here. me and one other anon were going thru the beastforums and that anon posted this and deleted it a minute later. i've been hanging on to it just in case. i think they had an account there maybe because i went to the same page and it was all 'members only' but idk
sorry i haven't been checking up on this thread cause of all the gosh darn infighting
(USER HAS BEEN PUT OUT TO PASTURE) No. 703223
>>703217I really hope this thread doesn't start getting blackballed by weird, random and suspicious bans now that "certain person(s)" have decided to intervene with actual (unpunished) derailing and off-site drama. It's wild to me that
>>702953 warrants a ban, but the bullshit and misdirection upthread that went on for paragraphs somehow does not.
No. 705226
>>705121Apparently FBI is getting involved since Snakething skipped town. His mom knows of the whole thing and she'll probably get in trouble too.
There was also another main group called The BBB, which stood for Beasty Beast Beasties. This was mentioned once in this thread but not very detailed. A lot of these people, including Kero, in the first released leak were members in this group. They all shared RLC (real life cub) content between each other via encrypted chats. RLC means both child porn and beastiality involving baby animals.
No. 705336
>>705319>>705319Message forwarded from Snake 2 weeks ago said “Good. Packing up to run from the LAAWWWWW”. Officer confirmed that the residence, Snake’s mother’s, was vacant. Officer overlooking his investigation will be returning Monday. Snake is still active online.
Police were sent to Sangie’s home. Was unable to make contact/no one answered the door. A police report and evidence via email was submitted today. Also confirmed by a SOAR official that Sangie is not a registered sex offender and was not arrested for anything (that he could find) relating to any time of pedophile activity. Was able to find him in the database however for previous arrests. Official was however also able to confirm that the address is current, driver’s license was active and Sangie’s last contact with police was 2015, listed as a “victim”. Official is not able to tell me what for. Sangie is still active online.
Text message screenshot was forwarded of 1 of the individuals listed as a RLC suiter being kicked out from their residence. Source asked not to name who it is YET.
More will be updated when I’m actually able to say more. A lot of this is due to avoiding tip offs, police involvement and FBI.
No. 705340
>>705336Thank you for the update anon. Do we know if Kero is investigated?
He said he need to watch for his mental health. Is silent since that day.
I wonder if he run away too?
No. 705463
File: 1538844428236.jpeg (Spoiler Image,136.26 KB, 750x1334, 2BB1C8BA-075B-4EE4-A1D5-1662E9…)
Recently been in contact with Snake, Sangie and Kero’s PDs if proof is required. Will only let me upload 1 pic.
No. 707723
>>707658So, why not just redact the names/faces of innocent family members (if shown - I personally haven't seen Simmons' family members' full names or likenesses on a public platform) and leave the rest up for reference? If he already knows about KF, anything he might've done in response (like fleeing) has already happened. This seems shady.
Maybe keep all personal info and references preserved in a zip file of some sort for now, but forbid overly detailed public discussion temporarily (like Admin asking us to temporarily stop discussing Woof here)? Outright deletion is too much for too little proof that this is happening, IMO.
No. 707846
>>707607yeah, nah, not gonna happen unless police contact admin themselves.
and if they're serious about it then they will
No. 707972
>>707846I contacted admin about it the best I could.
Just hope they aren’t COMPLETE morons.
No. 708031
>>707972no, the POLICE has to contact them, otherwise any furry can pretend to be a cop and have this thread shut down to save face.
tell your "cop buddy" to send an email listing their badge number, precinct location, etc and the reason why they need it shut down. shouldnt be too hard now should it? :^)
No. 708054
>>707810First of all, this isn't KFs and coming here to ask us to delete information? Not going to happen. That's part of this site is that nothing is deleted.
I also highly doubt that the police are giving some rando on the internet investigation information. So much of what's been posted by this police informant makes NO SENSE. Use your brain.
We're not out here posting about family members or children. We're talking about animal abusers and nabbing information on them to have them pay for their crimes.
If they don't, at least we know the court of public opinion will have these humans forever regretting what they've done and being unable to escape it.
Talking about these crimes, exposing these criminals is NOT going to halt a police investigation.
Either you are completely trolling and trying to hide evidence of Snakething/ Levi Simmons being involved in animal cruelty or you're being absolutely had by another troll.
Do not stop talking about these monsters, do not stop talking about these crimes, and do not delete any information on them. HIDING information during an investigation? To help the investigation? No. No. Just no.
No. 708075
>>707607Is this grounds for tracing an IP? Who besides snake would post this kek
>The cop is so upset about what is going thereHaha what
No. 708121
File: 1539127144309.png (666.95 KB, 622x605, eTjR0vC.png)
No. 708122
File: 1539127162981.png (266.77 KB, 399x468, eC3FZde.png)
No. 708123
File: 1539127177330.png (372.11 KB, 605x559, ERIVpJZ (1).png)
No. 708136
>>708121Mother fucker
Mother fucker
I'm so angry
Bitch has a full erection while petting a dog and forcing his face into it.
Kill this man.
No. 708269
>>708054KF posted his family's faces and the kids faces. They received death threats. That is his concern as well. If you don't believe the info, call the fucking police yourselves cause all I'm seeing is a whole lot of big talk and no action.
I've been up to my goddamn neck in this shitfest TRYING TO GET SOMETHING DONE.
I have no reason to lie. Nothing to gain. I'm trying to give as much detail as they will let me. He flat out told me I cannot disclose certain details. Again, CALL. THEM. YOURSELVES.
All he asks is that his family info is deleted, the pics are taken down, anything that can jeopardize his investigation, to be taken DOWN. I hate this fucker more then anyone can imagine and I don't want him to walk! Why is that hard to understand??? I've given proof of what I'm able to and yet there are STILL people here being all ''nah you lie''.
Fucking ridiculous.
No. 708294
>>708286I didn't have any of the contact info while I was on the phone and in my car.
I emailed KF about what is going on and if they email me back, I can pass on the officers info so they can speak to him directly. Simple.
The officer knows of KF existing and called it a ''slanderous website'' (probably told that by others, idk) and that was the extent of his knowledge on it. If there's a way to contact the admin directly, then help me do so and I can give that info to the officer. I've said before in the early parts of this thread that I've never used KF or LC so I don't have intimate knowledge of how to contact anyone in charge.
No. 708305
>>708294>If there's a way to contact the admin directly, then help me do so and I can give that info to the officer. Grizzly Pull up your big boy pants and join the forums and PM Null. It's not that deep lol calm down.
KF won't take down the posts but they might redact family names and edit their pictures if you ask nice enough (don't sperg). And what does KF being a 'slanderous website' have to do with interfering in the case? Snakething still molested his nephews and traded CP regardless.
No. 708309
>>708305I was banned. -__-
It literally says banned for calling the cops.
No. 708314
>>708309Wait until you get an email response or forward Null's email to the police. They can contact him that way. You're making this a lot harder than what it is.
By the way Nick Bate got arrested and convicted and none of the information about him was taken down on KF.
No. 708323
>>708314I'll have to have people on the forums get info for me to forward then since I can't get on.
I don't know who Nick Bate is.
I personally don't care if Levi's stuff is up, it's just the family being threatened that was the biggest concern. If people are making death threats against the family, how can he take anyone trying to report Snake seriously? The kids and family members' faces did not need to be up there. I tried to get that post taken down but the report was denied.
I'm trying to do what is instructed of me the best I can. I already had a hard time explaining how 1 cop wanted me to basically bait one of the accused into handing over more info. It's seriously tiring. I'm sorry I went off but I'm just frustrated over all this being asked of me and making sure no one gets away with any of what has happened.
No. 708325
>>708309I want you to reread this as many times as it takes to get through your head.
We are not KFs. We cannot (after a certain period of time) and do not delete information.
You're plight here is useless. And you still haven't answered why the police would tell you, a random person on the internet taking part in this online forum, such IMPORTANT and CRITICAL, and DELICATE information, which you could easily post about yourself.
You make no sense.
Look, good on you for trying to get people arrested, but you're literally talking to people who have nothing to do with how either of these sites are ran.
There is no information on family or kids here. Leave it alone. Leave the police alone and let them fucking work.
No. 708350
>>708323Bruh if you don't know how to find Null's email or Kiwifarm's legal email you shouldn't be helping the police. I don't know what to tell you.
I just remembered KF deleted a faildox on the ZooSadist thread. It's possible they will delete the post of Snakes family members. You sperging out isn't helping. People on the farms think you're Snake or you're trying to defend him.
No. 708351
>>708325I'm only posting what I'm allowed to say. He flat out instructed me to NOT disclose any information in our phone call except "Do your best to see if you can get the family's info taken down." and that he is trying to make sure that if Snake did do any of this, he doesn't want to risk any of the info being tainted or tossed out.
"And you still haven't answered why the police would tell you, a random person on the internet taking part in this online forum, such IMPORTANT and CRITICAL, and DELICATE information, which you could easily post about yourself."
Call. Them. Your.Self. Then.
I've been calling, emailing, doing whatever form of contact is needed short of walking in the station myself if I was actually local. If people doubt the info, then verify for your own peace of mind by calling them. There is literally no reason to lie about any of this. None of this shit is funny or a joke. I didn't know things were unable to be deleted after a certain amount of time. Again, never used LC. I've never once stopped anyone from calling to verify. Please do so.
No. 708357
>>708351>instructed me to NOT disclose any information in our phone call except "Do your best to see if you can get the family's info taken down."Except that's not what you said.
>>707607>OFFICER IN CHARGE OF SNAKE IS ASKING NO MORE POSTING ABOUT HIM.That's what you said.
YOU did not clarify yourself, making you look like you wanted everything about him deleted and hidden. You have no one to blame but yourself for people's suspicion.
No. 708371
>>708356>I can't get on the site.TFW you aren't hiding behind nine incognito tabs.
>I'm having people give me the info and was given 1 email address which was just now replied to by I believe Null so I will continue on with that.Make sure you clarify yourself and understand why people were suspicious of you before you send the email. Forward his email address to police too.
No. 708377
>>708371I am. I apologize for being vague. I was in a panic once he told me that everything could be tossed out. I seriously don't want that.
Forwarding Null's contact and giving the officer's contact to Null right now.
No. 708769
File: 1539174664864.png (64.28 KB, 830x1042, Screenshot_20181010-133005~2.p…)
So this is pretty offtopic but damn, Shane is going to catch some shit for collabing even though there is no way he could have known
He took it down but a mirror account still has it up and the comments are all like pic related
I wonder if he will address it
No. 711492
Ok this " take everything down" shit is really strange, i mean i don't doubt its possible an LEO is so ignorant or incompetent he truly believes a serious accusation of child molestation with real forensic evidence that could be obtained will get thrown out due to the dreaded cyberbullies. But even if he believes that it doesn't matter.
I don't have the stomach or the patience for the full logs, but it's my understanding there's pretty much no doubt at best grooming of minors happened alongside trading/producing CP, at worst there could be multiple instances of shit far more heinous.
Those victims are gonna narc hard with the CPS investigators no doubt already involved and both parties responsible will be up the river.
I don't believe the fbi confirmed with any of these fucking tryhards that they're involved, but they are. They're gonna bring down the hammer on the obvious CP ring tangentially involved and if they can't bring charges on the zoosadists they sure as shit are going to keep tabs on them and they'll be some of the first suspects of any murders/violent sexual crimes. And personally my biggest fear is that were honestly too late to prevent that, they just were smart enough to not talk about it.
I mean this is all truly awful, however I'd really not lose all hope. The fact its come out at all is horrifying but good in the sense now we know where to start looking for more of these monsters.
All right now for some kinda blogpost/power level shit.
I was already pretty distant with the greater furry community, but i seriously can't fucking tolerate these last few ties i did have.
It made me think a lot about how as a teen furry i experienced grooming and zoophilic shit shoved down my throat. It was actually really gross and inexcusable and whereas there were at least some responsible adults in anime and stuff trying to take action about that kinda stuff in that fandom, fucking furries were more content to kek to themselves about how "stupid" minors are, and totally ignore or excuse all these fucking creeps in their midst.
So already that was a thing and now this shit? No. Fuck it. People were right and it at the very least turned into a gross and dangerous fetish community, and at the most was just always that.
Can't even see softcore furry porn anymore without kinda feeling sick. Plenty of artists draw anthro and represent themselves with animal like personas without being spergy fetishy murrypurry fucks. And that's something these "not all furry" retards i keep seeing are content to not consider, probably because they are degenerates themselves.
No. 711762
File: 1539415993237.png (105.46 KB, 942x798, evil.png)
Around a month ago (during the leaks) he started getting hate. I guess he was exposed as a pedo? I haven't heard of him in the leaks though.
https://www.furaffinity.net/user/lavadog429/https://twitter.com/lavadog_ashpaw No. 711922
>>708725This. Why is it taking so long?
>>707607>>708351Super misleading and suspicious.
Also we don't/aren't allowed to post/talk about people who are not involved or relevant, so what was the point in coming here then?
>>701017His mom was brought up because she fucking lets him around children. That is all.
No. 712043
File: 1539461839326.gif (8.43 MB, 576x324, giphy (1).gif)
I ventured into this thread because I thought I was going on a cringe rollercoaster but I actually found myself in hell and I feel like I must go to church tomorrow to cleanse myself even though I did nothing. This was a fucking ride holy shit
No. 712070
>>712043I think the reason this thread died down is out of feeling helpless and needing a break because this is the worst shit I've ever seen in my life and I've seen alot.
Also waiting for confirmation on arrests so it's best to lay low.
No. 712277
>>711761>>711762His handle/name does not appear in the list grepped from the logs, but KF has a thread on him.
>>712043It's not like the OP didn't include a warning.
No. 720897
>>720851Honestly, what the fuck is wrong with Kiwi.
They're all fucking talk but nothing to show other than bullying the world's most pitiful lolcow Chris-chan.
Nice to know that these degenerate fucks will get to run away like nothing ever happened. Then the next time they start producing more shit, it will be even harder to catch them.
No. 720988
>>720786Thanks for telling us. Can you give us relevant screenshots? I cannot see his tweets anymore! I wonder why he is hiding, when he is innocent…
(we know he isnt)
No. 720996
>>720786Kero was fully doxed before this thread was even started.
>>720851>>720897Have you looked at Animal Control recently? They have doxed 6 others, Sephius Rivendare being the most recent. There may be more threads being compiled in Proving Grounds.
A couple of months ago Null and a few others were actively helping CWC after the Idea Guys swindled him out of 6k.
No. 721723
>>721708Oh thank you, sweet sweet justice.
I can't wait to see them scrambling around like rats.
I'm sure they'll be loved in jail.
Too bad we can't have instant updates from the cop himself
No. 721731
>>720786Do you have any caps? His Twitter is private.
The comments are the same on YouTube, it’s awful. People just mindlessly defending him, calling it petty drama. They have no fucking idea how vile he is, and the horrible things he’s done. It makes me sick.
God please let him be next.
No. 722672
>>722174Maybe that's being investigated and is coming? That requires witness interviews, I would expect. His sister better be cooperative and not as fucked up as his mother.
Levi getting charged is a bouying breakthrough, here's to it leading to further arrests.
>>720996I don't see proving grounds as I don't login, but yes I check the rest.
No. 723977
Over at kiwi, it has been revealed Levi Dane Simmons has been removed from the coos county jail roster.
A "furvenger" or someone in contact with them, at the time of the arrest, confirmed that in addition to an even greater amount of logs than were leaked to the public being given to authorities, Levi's devices were surely seized as potential evidence.
It is extremely likely, due to the nature of the damning evidence and seriousness of the potential charges, this indicates a change from state to federal custody. Basically, that the investigation is revealing enough evidence that federal charges are likely or incoming. It is also possible he is being moved for purposes of further investigation.
It has been stated Levi's mom had some skepticism, however, is now aware this is much more serious than bullying on the internet, and gave Levi up freely with a statement that if it's true he will "get what's coming." So, if he were released, which is very unlikely, it is likely he is not welcome at home.
Levi is, at best, couch surfing or homeless while out on bail or with pretty damaging misdemeanors that will bar him from animals and likely as a result his minor family members, and at worst is about to be ultra fucked on the path for federal prison, or already faced some unfortunate "accident."
Also relevant: on Twitter there was this thread:
https://archive.fo/ZfOAF Tl;dr some guy is pretty certain Levi is the same Levi from Oregon that raped his ex-gf, and notably, Levi was not convicted because he claimed he was too autistic to understand it was rape. If true, this clues us into the likely prosecution strategy, not that there was ever any doubt they'd try to pull the autism card, lol.
I'm pretty sure even autistic kids know not to fuck puppies and kids most of the time.
That's where were at right now.
No. 724085
>>723977Also wanted to add, i mention Levi's mother because I'm still hearing rumors that "she knew" and "is being investigated for endangerment" and "its her fault" etc
This is based mostly on Levi claiming that his mother knew about the CP. Spoiler alert! Pedos are not reliable narrators and have lied like this in other cases.
I don't honestly know what's going on, but the person that was in contact with both her and the police emphasized that she likely had no part in this and never knew. I've heard rumors they are up to their ears in cps and weens other than that.
So yeah hoping that people leave the family alone if that's going on.
No. 724550
>>724419I'm with the kiwis that i don't trust these guys anymore…i didn't realize it was them behind the original rumors Levi was on the run and then it turns out that was never true? So they suddenly get hacked and suddenly start a speculation that its statue of limitations, which, given dates of abuse in the logs, seems unlikely. Something stinks like dogfuckers.
There's no way its going away though. I looked into the logs and cops/fbi are not dumb. Its INDISPUTABLE he molested a child and shared pictures intended to be erotic of the victim. If that's all very clear from the stuff that went public, then i don't even want to speculate what's in the ones we don't have access to. Don't envy those investigators one bit.
No. 724928
>>724565Ok i feel dumb for ever trusting these dumb furfags…let's look at this time line.
So this Grizzly character, according to "Shibe" whom was a part of this group and left because drama, is a huge drama whore and attention monger.
It was said she was constantly jumping at the chance to be the one to talk to the public and police. She was the one that started that shady rumor that "Levi was on the run" with the implication his mom was aiding and abetting. This was impossible, because there weren't even any charges yet, and according to their own story they Later came out with, they hadn't given all the evidence yet.
Later grizzly is like "got em" and drops a photo that supposedly "proves" the volume of stuff given to police and fbi. At this time, these "furvengers" state, oh he never ran, the police only just got him and his mom gave him up with a statement. So…he was never on the run then and his mom wasn't hiding him like they implied before?
So then, of course, he does end up in coos county jail…and then suddenly he's released, no arraignment, no anything, they start this weird speculation that its statue of limitations on animal cruelty…except…there was animal cruelty Levi committed in the past year per the logs, and those statues are for over two years?
This "shibe" character claims that, grizzly had a melt down over the zoos they were working with, dropped their doxx (somewhere??), the furvengers mysteriously got hacked and had a bunch of zoo porn posted, spooking them, and now they all wash their hands of it, but oh listen to this neat furry fandom podcast u guiz.
At best these are a bunch of LARPers who don't actually know a fucking thing and are probably causing hell, headaches, and liability for the coos county PD. They may be the reason we won't see shit happen until the FBI can make the indisputable child exploitation case. It WILL happen i promise, the furvengers aren't the only ones that got in contact and sent information. The ones that actually did in a useful way are just not autistic or shady or generally do not care about drama and attention. Real kids and animals are being hurt and they just want the authorities to sort it out, as they should.
At worst I'm starting to suspect they are in on it. What better way to deflect attention from a bunch of dog fuckers and potential child molesters than to rat out one, attempt to sabotage the evidence so it looks to the court like some baseless internet drama/role play, let that play out whether he gets caught for the real evidence or goes free. Win win. Either he gets all the blame for abusing kids and dogs while the other sickos go under the radar, or he goes free and it delegitimizes in the eyes of furries the truth that there are literal child and animal abuse rings in their midst.
What's REALLY suspicious given all this, is grizzly's seeming refusal to acknowledge the existence of woof, the severity of his alleged crimes, and give a straight answer on whether he was ID'd or not. We know woof was at least smart enough to attempt to cover up his identity and personal life, he's probably smart enough to round up a bunch of retarded furries also secretly into this shit to create a ruse cruise.
Something really fucking stinks and we need to start ripping the walls out to find the source.
No. 724954
>>724928Grizzly was milky as shit. She was posting hints and oversharing sensitive information on here like a dumping ground. She really wanted to be a hero in all this. She left the first investigation group due to herself claiming she needs to focus on her kids and leave the rest to authorities. Which was a lie. After she left, she was still dumping info in the Furvengers group. One thing by to note, Dogpatch Press was in that group as well. DPP is known to start drama out of pure boredom. When this zoosadist investigation all started, DPP tried so hard to turn this into Right Wing Fascists Are In This Group. The only source he had to "confirm" his claims were the fact a few of them said something he didn't like.
Back to Grizzly, once she joined Furvengers and left the other group, she started blocking members of the first group on Twitter. Possibly because Dogpatch Press harassed her for it. She made a tweet thread claiming she never blocked anybody, and shortly after this the people she blocked were unblocked. She wants all the attention and people to do everything she says.
No. 725011
>>724954Hmm then grizzly just seems like some wannabe hero LARPer. Seems true she did submit all the evidence she had, but her contributions are pretty much worthless and even detrimental besides that. I suppose if she really is just some LARPing idiot looking for e-fame that does explain all the made up bullshit about Levi being "on the run" and shit as if real life works like a crime show.
But for the others…i still think something seems really fishy here. Not only because of the degree of LARPing jackasses they let in on this and allowed to run amuck with bad information, but the whole secrecy, hacking, working with zoophiles in exchange for immunity… I just really can't shake the feeling that's all about deflecting and going back underground.
No. 732791
File: 1542321524339.jpg (13.63 KB, 300x300, Woof with dog.jpg)
Ruben Marrero Pernas / woof / Warg / Warg Schwarz / wolfss / Ulfr / Schwarzweiler
Ruben Marrero Pernas (‘woof’) is a Cuban Zoosadist who recorded himself torturing, sodomising, killing, mutilating, and pleasuring himself with the remains of at least two dogs. There is strong reason to believe that he has done similar things to more animals.
Alongside zoosadism, Pernas is also a prolific zoophilliac and dog-sodomiser. Pernas has photographed and filmed himself fondling, fellating, and engaging in vaginal and anal sex with his own dogs on the zoophile discussion board, BeastForum. Pernas has also written detailed written accounts of detailed sexual encounters he has had with animals, including animals that do not belong to him and animal carcasses.
Pernas came to the internet’s attention via his conversations with Levi Dane Simmons (‘SnakeThing’). There, Pernas shared with Simmons photographic and video zoosadist content. After the recent Zoosadism Leaks, 'woof' found himself as the most notorious member of the exposed ring owing to the almost unique levels of depravity of the content he shared with Simmons.
Social media/forum accounts
BeastForum (wolfss):
http://archive.li/7yu87Accounts as 'Ulfr'
Agregame:
http://archive.is/QgwiXAmigae:
http://archive.is/YmXOcBackpacker Dating:
http://archive.is/vq8LECubaRed:
https://archive.fo/Nj11UDevoted Singles:
http://archive.fo/KOmFbTender Singles:
http://archive.is/acuWnAccounts as 'Schwarzweiler'
DeviantArt:
http://archive.is/6nmkNFurAffinity:
http://archive.is/mzBJd Misc Accounts
NationStates (Schwarzheim):
http://archive.is/kviBzPinterest (schwarzwolf12):
http://archive.is/FVUsJ Due to the complexity of proving woof's identity beyond reasonable doubt (plust to save people's eyes from needing to read/see what he's done), I'd like to refer readers to a set of Google Docs on his case.
https://docs.google.com/document/d/1m8diuw-otCReYFt829lQvgXvr6Bm6FFVhcBxXbvgAVA/edit?usp=sharingWe've included an email in the email field in case anyone wants to send us anonymous tips to further expand the Gdoc.
No. 732845
>>732791Thanks for compiling it in this form and distributing it.
We had this a month ago if you search his name upthread and were accused of faildoxing.
He likes long, multi-day hikes into remote forests and is part of a stray dog rescue group. I mean, even if this wasn't woof, there is so much shit against this particular guy in his own right.
No. 732847
>>732797Well there was that talk that Woof would give up some deeper, worse ring if his identity was protected. Idk if Null just hid (and mocked) the icecream shit and how it lead to the dox out of butthurt? Jealousy that someone not him found it first? Or that he fancies himself saviour of the universe and will spend the next decade browsing- I mean exposing- nasty rings of abuse material.
Inb4 Dyn comes back for another derail session.
No. 732853
>>732843Poster/compiler here. Some earlier members of our broader group who were digging up woof spaghetti'd out and made the rest of us look like speds: one guy prematurely went to the Cuban Embassy, and another leaked our plans to this board.
The KF staff reaction wasn't helpful and they clearly caricatured the work we were doing and derailed this thread. But there was an opsec failure on our part, and we lost credibility with players such as Null, ZedKissed, and Cricket.
I do think their response has been governed too much by resentment and aloof condescension rather than analysis and respect for the case. We've made the case clear, but whenever we put it to the KF admins they a) claim we're moronic amateurs and we should back off, or b) that somehow the entire dox is a red herring that we're too blind to see.
At this point we've been sitting on this for well over a month and sadly the KF administration isn't budging, and I believe it's out of personal animosity. Which is a shame, but I'm not going to try to fight them any more. I do think they've been very stupid.
>>732845Np. Sorry for taking so long. Was hoping to see it up on KF, and sat on it for a long time hoping to see the situation change. The work in this thread was great, and it was just some speds from KF decided to crash in and derail things because of personal frustrations and prob a little bit of jealousy.
>>732847We shared some of the leads woof dropped with KF's senior staff. They aren't following them up.
No. 732866
>>732853>whenever we put it to the KF admins they a) claim we're moronic amateurs and we should back off, or b) that somehow the entire dox is a red herring that we're too blind to see.I'm not sure if he's been thread banned and had his post deleted yet, but a user in contact with the pm group stated the admins don't want to make a thread on woof because they believe the dox are probably real but a thread would not be "milky" enough and just be a bunch of a-logging and disgust.
Ummm ok i guess ruining a the reputation of someone that literally raped, tortured, and murdered animals isn't good milk, then.
KF disgusts me with their priorities. They're no better than the furries making this all out to be drama and not heinous crimes.
No. 732880
>>732847>Inb4 Dyn comes back for another derail session.Mods/farmhands claimed Dyn was permabanned. Not gonna be surprised if an "anonymous" poster with his typing style comes in to try and dispute the dox and defend KF, though.
It really sucks that KF suppressed this, but I'm not shocked. At least this place is in the clear for continued discussion and exposing of these sick fucks.
I'm glad LC never got
too incestuous with KF, despite how hard Dyn and Null tried for literal years, or we'd be seeing the same shit here.
>inb4 >>732791 mysteriously gets deleted and the anon who posted is suddenly banned No. 733084
>>732847I kind of wanted to clarify for you, though its touched on in
>>732858 's post.
The intel woof was offering was, from what I've heard, supposedly secret access to a dark net site called Animal's Dark Paradise.
The problem? My research indicates ADP is one of the easiest dark net websites to access, you can even reach it through the clear net. It is for this reason speculated in the dark net community that ADP is an FBI honeypot. The easier shit is to get to on the dark net, the more likely it is.
So yeah like the compiler said, chicken feed intel. It didn't take a lot of research to know what was up with ADP.
Of course, the compiler in here states there was more than one lead, but its probably on the same level as ADP.
I just thought the anons here would appreciate that context, because it says everything about woof's "boohoo don't doxx me" crocodile tears. He's probably only gone on the down low, I'm sure we all want him to be afraid for his life, cause this is one situation that deserves all the a-logs.
I guess i can KIND OF see KF's point there…if he offs himself or gets murdered and then people don't believe it was him that could be hot water. But the fact is he's in Cuba, they won't care to make a stink and in fact it may play to our benefit, since their government looooves to subjectively enforce bullshit and disappear or fuck with people.
Yes Cuba doesn't have animal abuse laws, but they most certainly have a habit of just enforcing whatever. That's actually one of the many reasons he is scared. People act like Cuba is some kinda place no one will care, but why do you think he's trying so hard to get to the u.s. as evidenced in the doc?
The u.s. is not a much better choice, but we at least have due process and shit.
Cuba's got a long rap sheet of generally not having much if any at all.
So i hope that puts it into perspective that his intel was crap and there are possible life ruining consequences for him here so don't lose hope.
Jesus i never thought I'd kinda think cuba's lack of human rights could be a potentially good thing but here we are. Fucking zoosadists.
No. 733137
>>732847>>732853Null declared the moratorium on discussing Woof immediately after not only the ice cream shop dox but also after Woof's use of the pseudonym "Warg Schwarz" was discovered on Illone's memorial page. It's one thing to dismiss the ice cream shop sperging. Dismissing the discovery of another of Woof's pseudonyms is
ADMIN FAIL.
No. 733138
>>732847>>732853Null declared the moratorium on discussing Woof immediately after not only the ice cream shop dox but also after Woof's use of the pseudonym "Warg Schwarz" was discovered on Illone's memorial page. It's one thing to dismiss the ice cream shop sperging. Dismissing the discovery of another of Woof's pseudonyms is
ADMIN FAIL.
No. 733139
>>732847>>732853Null declared the moratorium on discussing Woof immediately after not only the ice cream shop dox but also after Woof's use of the pseudonym "Warg Schwarz" was discovered on Illone's memorial page. It's one thing to dismiss the ice cream shop sperging. Dismissing the discovery of another of Woof's pseudonyms is
ADMIN FAIL.
No. 733167
>>732791Fucking hell I was waiting for this post.
Totally thought everything had gone and died out, especially when ADMIN was censoring any mention of this guy. Just so we could get a mention of a beast site that was already previously mentioned, whoopdie doo.
Thanks for compiling this.
No. 733472
File: 1542422674070.jpg (64.64 KB, 549x410, 67956345.jpg)
>>733084Hey, I've been following this thread and am amazed with the intel on woof and I wanted to share what I posted on KF regarding my "investigation" on 8ch's zoosadism and the links to ADP. Especially since y'all seem to have a bit of a different viewpoint on this all than KF and also simply for more publicity. This was my post:
>I wasn't planning on making an account here despite following this Zoosadist thread since it came up but after this stuff about 8ch became tangentially involved I decided to do some research myself and unfortunately what I found was so horrible I couldn't keep it to myself despite how non-relevent it may be to the original topic. Woof-tier stuff.
>I've used 8ch a bit in the past and I know there was at least one well known bestiality thread called /zoo/ that could be found on the front page that always made me feel uneasy about using the site. (that and the Toddlercon board but thats another subject all together)
>It seems there are four main zoophilia boards on 8ch>/zoo/ - by far the most popular, """"normal"""" bestiality (aka non-abusive, if you can call it that :\)>/zoocore/ - unlisted, doesn't come up on search. rough sex with animals (hardcore+zoo=zoocore) but no torture or killing>/zooscat/ - """people""" who like to eat animal shit (:_(>/necrozoo/ - people who like to fuck dead animals. ironically even gross fucks like these are repulsed by people who torture and kill animals and even has an animal PSA as part of their sticky
>While investigating /necrozoo/ I noticed that the second bumped thread was one about a 500mb MEGA archive of videos from a now defunct darkweb site called Animal's Nightmare/Animal's Dark Paradise posted in 2015 with the recent posts being users and the board admin talking about how there are two animal torture/snuff video included and if they should be taken out and the archive reuploaded.>Thread Link:http://archive.is/aU0aOhttps://8ch.net/necrozoo/res/36.html>Censored screenshot:https://imgur.com/a/lyPvRvq
>Background info on Animal's Dark Paradise/Animal's Nightmare:https://deepweb525.wordpress.com/2016/05/20/animal-tortures-in-the-deep-web/http://archive.is/rNfxShttps://www.youtube.com/watch?time_continue=2000&v=no5snQFsYlYhttps://youtu.be/81BcGiNdCE4
>Because my sense of curiosity and doubt got the best of me I decided to download the archive and click through the videos to confirm what was said.90% of the videos were the same necrozoophilia stuff posted in the furry telegram chat archive (same videos of men with dead deer, also some videos of dead racoon and I think coyote genitals). HOWEVER there were 2 EXTREME animal torture/gore videos included:
>EasyToOpen.avi (same as mentioned in the wordpess site above)>Gushy.mpg
>These two videos can also be seen posted by the 'Administrator' of Animal's Dark Paradise as seen in the background info links above.
>What I found interesting was the dates of the videos in this archive. A bit earlier here a few user were discussing if this animal torture porn is a new and recent thing however the OP of this archive of 8ch was posted in 2015, nearly 4 years ago. All but one of the videos in the archive were dated at or around 3/27/15 IIRC (one being April) WITH THE EXCEPTION OF ONE: Gushy.mpg which was dated September (I think) 2012. Nearly SEVEN years ago, and its not even proof thats when the video was made.
>In-depth description of the two videos:EasyToOpen.avi: around 9 minutes long. Clothed man outside with dirty white puppy on top of some cardboard packaging as a mat. Uses two dildos to violently rape the puppy in both its anus and vagina until it is bleeding. Seemingly stretches it orifices out with his fingers to show the damage, looks mutilated. Jump Cut to him with no pants on. Fucks the puppy with his incredibly small penis. Jump Cut has pants back on and dog has already been disembowled with its abdomen open. Throws the puppy offscreen
Gushy.mpg: around 23 minutes long, much lower resolution, effectmatrix watermark in top left corner. Same guy inside now. Wears black gloves and spreads lube on a black puppy's behind. Puppy has a small rope/string along its neck .Jump Cut no gloves anymore, puts possibly is masking tape + duct tape along the puppie's mouth. The same two dildos as the other video are being used to rape the puppy in the same fashion as the other one, he has two much larger dildos along with him as well. Somewhere around here he takes the tape and string/rope off of the puppy. Uses a large knife to slice under the tail of the puppy. Impales one of the larger dildos into the wound area. Heavy bleeding. Uses large knife to cut the puppy's chest open disemboweling it, and takes the large dildo out from where it was inserted. He then cuts off the right arm and ear of the puppy. Shoves the dismembered arm into the dog's mouth. Starts playing with the guts with his hands, then thrusts into the guts with one of the large dildos, followed by the dismembered arm. Leaves the arm laying on top of the guts. Puppy is still barely alive with leg twitching. Video ends with him putting the remains into a black garbage bag.
>Finally the last thing I want to mention is that there are at least 3 other just as horrifying videos floating around the internet that I have yet to see:
>Coki>ylym>Old. No 7
>DeathAddict and Quora post mentioning them:https://www.quora.com/What-are-some...videos-youve-seen-on-the-Internet-or-dark-webhttp://archive.is/PFoVrhttps://forum.deathaddict.com/threads/dark-forest-aka-ylym-video-discussion.2973/http://archive.fo/nlilZ
>Where I first saw them mentioned was when I looked closely into the background of this video:https://youtu.be/WOIe_1RMdGo
>I was going to just report the 8ch thread and move on but I dont think I could live if I didn't tell anyone what I saw. If you look at screencaps of ADP you'll see the EasyToOpen and Gushy were both posted by the 'Administrator' of the site and both of the videos were done by the same fat male. It's a stretch especially since the videos go back as far as 2012 but if some information on who was behind these videos comes out from Woof or whoever else (Woof says in his chatlogs that he was invited to be a Mod for ADP and he sent his raw film to other people for editing) I think I can rest a little easier at night. All I can really add is that he looks white (no face shown), mutters in English, and in the EasyToOpen video he uses a cardboard box from some sort of furniture or container as a mat and if you look closely the assembly instructions are in English.
Simply viewing this material is horrifying for me moreso than Woof's stuff because with this its as if Im the only sane person who has viewed these videos and I only came across them by chance.
No. 733516
>>733472Simply reading the descriptions of those two videos… I have upmost respect for law enforcement who have to review this shit on the job all the time.
And still, furries would rather defend these zoophiles, worrying about their reputation than bring the sick fucks out into the open and purge them
No. 733548
>>733472I-im going to go cuddle my old Kittie now, that's just too rough to read
Also
>Watch the YouTube video you linked>Site has furry art on the main screenOf. Fucking. Course.
No. 733570
>>733472I really have no idea how 8ch still exists with the disgusting content they host.
There’s a thread dedicated to taking creepshots of peoples children, talking about children they’ve been grooming.
It’s horrifying and it makes me sick that nothing is being done about these people because it’s not “TECHNICALLY” illegal to post about it.
Thank god these threads have helped crack down on these awful people. There are still decent people out there.
No. 733931
>>733918As mentioned before, it is speculated ADP is actually an FBI honeypot, due to how easy it is to find and access.
My guess is they keep an eye on it to get any leads on potential serial killers, because to be quite honest, as were finding, taking down a bunch of people who are probably smart enough to realize mutilating animals will at the very least ruin their reputations for life, is easier said than done.
Even the most stupid in this ring, for example Nelizar, are proving hard to take down.
I've been told this stuff has been forwarded to PDs and the FBI many times over, though I suppose if you really think a tip about ADP and stuff is worth the 5 minutes it takes, that's fine.
But I just want people to realize that it may be part of their tools and surveillance, as well.
I hope we are helping tbh.
No. 733934
>>733918I’m sure people have tried to take down /zoo/ but watching zoo porn isn’t exactly illegal in the USA. That shit is on a lot of sites and I’d imagine the FBI wouldn’t really give a fuck.
There was a /zoosnuff/ board that had the most awful shit in it that I tried to seek methods of reporting to the authorities but people don’t take this stuff seriously at all. No one seemed to give a shit even when there was a user actually posting fucked up snuff videos they made on there. The board got deleted shortly after it was shared on KiwiFarms probably because they knew it was illegal to host. Fuck 8ch.
No. 733945
>>733931I get that the law is chock-full of bureaucracy but his fucking full name, picture and address are out there next to his indepth chat logs of his crimes. How is that hard to make an arrest?
>>733934zoophile shit is disgusting but I'm far more concerned with the animal killing stuff as are most people. And yeah thats where I saw mention of /zoosnuff/ and began my investigation into those underground boards on 8ch. Literally I just put zoo into the search bar and went from there. The archive with the puppy disembowling videos was the first fucking post under the sticky on one of the boards.
No. 733964
>>733934>>733945I’m not sure if this helps, but the FBI is extremely overburdened; there is too much to investigate and too few people to do it. Between international affairs, kidnapping, fraud, bank robbery (usually internal), hostage negotiation, terrorism, investigating child sex rings and exploitation, bomb threats, and idiots who still use the deep web. . .everything has to be prioritized.
Additionally, just because some sick fuck is still out there doesn’t mean there isn’t an open case on him and doesn’t mean he isn’t being investigated. Don’t underestimate how slowly the wheels of bueracracy turn.
Most of the time, it’s not that the FBI doesn’t care. It’s just that there’s way too much and not enough manpower.
No. 733965
>>733945I actually reported that /zoocore/ thread maybe two weeks back. I’m pretty sure it’s a repost from the telegram leaks but snuff shit still shouldn’t be so openly distributed. Last I checked, it’s still there. The whole concept of that board is probably illegal really since its focus is on inflicting suffering on animals for sexual gratification. I don’t see why /zoosnuff/ gets deleted but not that shit. I guess it’s because the admins care more about what internet vigilantes will pull more than actually not creating havens for sick fucks in the first place. I also remember seeing a thread on their support board, /sudo/, where someone complained about reporting cp on /b/ nearly a week ago and it still wasn’t taken down.
8ch needs to be shut down. The staff is mostly definitely full of sick fucks who hide under their freedom of speech schtick to host the most degenerate shit.
No. 734119
>>734075I am hoping the release of him is just another Nick bate where they take the evidence, release him, gather a reasonable case against him, then jail him for good.
Honestly scared that he's currently walking the streets, I hope atleast his town is aware so the local animal shelters/pet shops don't accidently give him any animals
No. 734389
>>734125nobody really knows, my guess?
A whole case can be thrown out for ill gotten evidence or pulling out the big stops too early in due process.
I really, seriously doubt they will let a molester of young children who then distributed content proving the molestation to other sickos free. But tbh, I do know trying to get evidence from Telegram in particular is a bitch and a half.
They might be having to build a case without the DIRECT evidence that he sent CP which would make this pretty tough to stick it to him for good.
No. 734582
I did some reading and, this is purely speculation based on some stuff about criminal cases with digital evidence, if they can't get the actual logs from telegram itself, the case may be made the logs could be fake. So they might be looking at needing to prove that its very unlikely the logs are fake, this would have to rely on other evidence, witness testimony, expert testimony, etc. That could take a long time. And if any of the evidence will come from the victims, they have to make it solid. Every fuckin defense that's had to defend a kiddy diddler tries the whole "the kid was led to believe they were molested" at least once. They have to be so careful in how they approach with cps and handle interviews.
That all being said nelizar is extremely visually impaired, cannot drive due to this, and cannot work a normal job. If his family has not taken him in again or cps has gotten involved and he cannot go home, we'd be extremely unlikely to hear from him for potentially a long time. And he's not charismatic enough to be a dangerous homeless person zoosadism aside. He's a hopeless spergy faggot.
No. 734990
I know it's the case that Cuba doesn't have any animal protection legislation on the books, so woof (see
>>732791) isn't going to face trial anyway. Best we can hope for is to maybe hope for social action by those around him irl or maybe the famously inconsistent Cuban legal system to get him.
No. 735010
Compiler of woof dox
>>732791 here. Someone (I suspect it may be from KF, but can't be sure) had the GDoc flagged. Here's the same document in PDF form.
https://anonfile.com/fcq477l6b2/woof_-_Ruben_Marrero_Pernas_pdf No. 737212
https://www.cibercuba.com/noticias/2018-11-23-u1-e129488-s27061-denuncian-cuba-violador-asesino-perroshttps://archive.fo/mMzFM[Google translate]
They denounce in Cuba a rapist and murderer of dogs
A note originally published by the group Cuba Against Animal Mistreatment and reproduced later by the CEDA platform (Cubans in Defense of Animals) has denounced the atrocious zoosadist practices of the Cuban Rubén Marrero Pernas (29 years old).
The testimony points to Marrero Pernas as a zoosadista who has filmed and photographed himself repeatedly torturing, sodomizing and killing dogs.
These are images he would have shared in a digital forum of zoophiles called Beast Forum, in which he has published "detailed accounts of sexual encounters he has had with animals, including animals that do not belong to him and corpses of animals," the activists point out.
"He not only rapes, mutilates and kills them, but he posts what he does in photos and videos that were sent to us by protective friends from abroad, today we only publish his photo so everyone knows his face, and one of the terrible photos of the unhappy puppy who raped, mutilated and killed", adds the complaint.
Among the most striking was his exchange with another subject, Levi Dane Simmons ("SnakeThing"), who has already been arrested in the State of Oregon (United States), for similar practices.
The CEDA platform has highlighted that Marrero had adopted a puppy in early April of this year and describes what was the fate of the poor animal.
"This individual, after being offered for adoption, tortured, mutilated, raped and killed days later in a way that it is hard to believe that a human being can do it, CEDA has graphic evidence that this information is true," note.
A worker until recently of the Scientific Pole of Havana, he was expelled from his workplace after spreading, in the last hours, his horrible behavior.
The Center for Neurosciences of Cuba has published on its Facebook page that, after verifying the complaint received from CEDA, Marrero has been dismissed, and the note adds that the institution has provided information "to the competent bodies for further action as appropriate".
"We found an individual who was apparently a good worker, a normal person, who could not imagine anything could commit these atrocious acts, and it turned out that it was the opposite," said the director of the aforementioned Center.
The article published by the group Cuba Contra el Maltrato highlights that Ruben Marrero Pernas "is sick but he is NOT crazy", he defines him as "a high-level psychopath, who can distinguish between good and evil, and chooses to harm".
"In a while it will not be enough to rape, maim and kill dogs, the threshold will rise and you will need more, as forensic psychology has shown, this man will kill a human in time if he does not put a brake on it. unhappy animals! We need a law that allows to arrest this man for similar barbarities!", concludes the note, which reiterates the need for an animal protection law in Cuba, which lacks both the old Constitution and the new constitutional project underway.
No. 737213
File: 1543065354308.jpg (160.26 KB, 1072x766, fired.jpg)
>>737212Found the fb post also, google translate applied. Source:
https://www.facebook.com/cneuro I'm glad to see the local animal activists are onto him.
No. 737215
>>737213precise post link also:
https://www.facebook.com/cneuro/posts/2016048265140012funny how they consider the ice cream dox sufficient, huh.
No. 737239
File: 1543073596881.png (11.9 KB, 472x107, arrest.PNG)
They got him!
No. 737282
File: 1543078375243.png (10.84 KB, 467x125, arrested.PNG)
No. 737293
File: 1543078854390.png (41.76 KB, 800x350, null.png)
>>733139Looking forward to hearing your reason for shutting down the doxxing on KF, Null.
No. 737309
>>737293it wasnt just him. it was zedkissed, the "master of doxing", and a handful of other admins and users as well.
they all thought it was "too informational to be true". the logic.
No. 737311
File: 1543080886548.png (767.88 KB, 921x624, upload_2018-11-25_1-50-13.png)
Posted in the A&H thread by Slimeball92A:
I found photos of Woof attending a CEDA organized seminar. In return of the existing info logs videos and photos, I got the photo of Woof with the puppy, which was the only evidence connecting him to the mutilation photos. His face already appeared in the sexual abuse videos, but before that no connection could be made between him and the telegram sadosexual photo sets.
I had to sit on the puppy photo as Woof knew exactly who took it, and had to wait until I had permission to use it, or was safe in the knowledge the photographer was safe from any reprisals.
upload_2018-11-25_1-50-13.png
The "congregation" is standard procedure for adoption. The adoptee is photographed and address documented.
He attempted to try and weasel out of the procedure, had he succeeded there would have been no connection between him and the puppy mutilation photos.
The animal welfare group had members working at the medical facility in senior positions. They already knew him. He started not showing up for work around the time his identity was being assembled.
He wasn't fired. at that point he was removed from his position to be relocated elsewhere in the facility. Almost all Cubans work for the government. In a communist society, you are merely downgraded.
He was outed, removed from employment and arrested in within 2 days.
Due to the Facebook and news sites stories the police finally took action. It was supposed to have happened 2 weeks ago with animal welfare taking the dogs straight after, but police didn't act. They already had information on him prior thanks to an overseas Cuban embassy.
The police moved so fast after the media picked up on it that the animal welfare organization weren't there as initially planned to be to take the animals immediately. The dogs were taken by "Zoonosis" The Cuban government's animal control division, it's basically a deathcamp for stray animals. Luckily the dogs were rescued from a Zoonosis facility very shortly after.
Information on the dogs that he owns has been suspicious. At the time of the planned raid he apparently had 6 dogs, at the time of his dismissal, the number was 3. At the time of his arrest the number may have been 2. This info may be erroneous.
Animal remains / bones have also apparently been found at his house. The sexual abuse videos were filmed at his grandparents house.
He has no connection with the military apart from his employment at the military hospital. He failed mandatory Cuban conscription twice for failing psych evaluations. All militaristic photos of him are all LARPing.
I hope that clarifies a few things.
No. 737317
>>737309Did the moratorium have to do with
>>737311, ie protecting the photographer? Was Slimeball92A's discovery made before Woof was doxed here, but he had to keep quiet?
No. 737334
>>737283>>737213>>737212HOLY SHIT this is amazing!! i thought nothing would ever come of this, but this is so encouraging
>>737293>>737309the dumbassery is incredible
No. 737336
File: 1543083995278.png (29.46 KB, 578x258, uh.PNG)
aaand of course, Grizzly is trying to take credit for Woof's arrest. She was completely focused on Kero and SnakeThing. Slimeball and a few others gathered info on Woof and spread the info. Not them.
No. 737374
>>737212>>737239>>737282>>737283>>737285I'm so glad this piece of shit was exposed, nabbed and arrested. It's amazing. Christmas came early. I really thought this whole thing was just going to fade out thanks to KF's retarded admins (I swear they must be SEETHING with embarrassment, rage and envy right now), and the apparent in-group drama that went on.
Thank you to all those who're a part of this investigation. You truly are heroes.
No. 737381
>>737366Null did. A few minutes after the location of the ice cream parlor was found, Null and admins deleted any mention of woof because of the "tism" and power leveling since a few members were basically confirming they lived in certain areas asking ice cream shops if they served a certain dish.
Even after all the information was gathered and looked very set in stone it was woof/Ruben, Null said he needed to have Zed and other selected users "check" before somebody submitted it to proving grounds in case of faildox. They checked and said it was a faildox, that's basically it. If anybody gave them even more concrete info it was woof, they still said it was a faildox and a setup.
No. 737386
>>737381Just goes to show how stupid and useless Null, Dyn, etc really are. They stubbornly refused to budge even when they were proven wrong multiple times, and one of them even came here namefagging to try and "advise" us to shut down any traces of the investigation on LC, too. Purely out of hubris.
If I didn't know any better, I'd actually wonder if they had some sort of stake in protecting Woof.
No. 737424
>>737407What I don't get about the ice cream shop stuff is that ultimately, that dox was correct. Right? Woof ate there and posted pictures from it. So what was the problem? They didn't like it because the method of discovery was too autismal? Isn't this very same level of autism how anons are able to repeatedly break Shia and HWNDU's balls?
It's just weird that they needed one of their 'people' to sign off on it. What, is KF the go-to site for doxing now? Are they mad because they couldn't take responsibility for the dox?
Why aren't they just glad that this fucker got caught? I don't get this at all. The site is getting hit again; I wonder if this is connected.
No. 737433
>>737381Not only after the ice cream shop was doxxed but after Woof's use of the pseudonym "Warg Schwarz" on Illone's memorial page was discovered by a farmer and reposted on KF. This pseudonym appears to have been key to the dox that followed.
>Null said he needed to have Zed and other selected users "check" before somebody submitted it to proving grounds in case of faildox.Where did he say this? I only saw his moratorium post. And was there ever a Woof thread in Proving Grounds?
Before the Woof dox I saw two people who weren't even furries incorrectly doxxed in the main thread, so I can understand the mods' frustration. They should have directed all doxxing to Proving Grounds from the get go to prevent innocents from being accused.
The glory seeking ZSIS members who attempted to negotiate with Woof were hugely
problematic on both sites. I assume these are the same people
>>732853 was referring to.
KF was at least correct in their assessment of Grizzly. When they banned her she came here to sperg for glory.
>>737386What was LC Admin's reason for redacting posts in this thread?
>>700611>>700649>>700679>>700689>>700852>>701274Other posts have been deleted entirely.
No. 737442
>>737433The posts removed were spergs from Grizzly. Not sure if she personally asked for them to be taken down.
>Where did he say this?This was in a PM group with the users gathering info on Woof.
>>732853 is one of the people who explains it a bit better. It seems like the visit to the embassy was a good thing after all.
No. 737443
>>737412
>You ladies are amazing.I'm a regular farmer and I don't have an account on KF, but credit where credit's due. Several of the participants in this thread such as
>>732791 obviously were not farmers and came here only because Null barred them from posting. Others were sharing info on both sites all along.
>>697277 is a Kiwi and posted the ice cream shop dox first on KF a few minutes before posting it here; then they posted
>>697293 on KF after it was posted here.
No. 737491
File: 1543096791742.png (20.56 KB, 800x99, admin.png)
>>737442
>spergs from GrizzlyI thought posts were not removed from this site unless they are in violation of the rules? Her posts should be reinstated as evidence of her glory whoring and as warning her motives cannot be trusted.
>>737466Yes. And while what Dynastia said about the non-Woof fail doxes in
>>701711 was true and reason to be careful regarding info posted by ZSIS, he steadfastly ignored the accurate Woof dox that were posted here. There is no denying the "Warg Schwarz" who posted on the memorial page is Woof.
Why did Admin here (attempt to) forbid discussing Woof
>>702125? Obviously she wasn't committed to the prohibition since discussion proceeded unabated, but we should be questioning her as much as we are questioning Null.
No. 737517
File: 1543099432984.png (329.94 KB, 975x414, oo.PNG)
Stream was quick. I'm pretty sure Slimeball was the one who sent Null this message.
Godspeed. They apparently locked up Woof because people were planning to kill him after the animal welfare groups posted about him.
No. 737704
>>737442>>737482>>737491Posts redacted where posts with information redacted to help the investigation.
Believe it or not, not everyone thinks this is a game for glory whoring, unlike Null. This is a thread for zoosadists, not pathetic kiwifarms drama. Keep the thread on topic.
No. 737721
>>737704>to help the investigationLet's face it, we all, including staff here, cooperated with KF's wish to suppress Woof/Ruben's information. And for as long as that attempt at suppression lasted, it affected our conversations on this thread. Dyn's visit here to derail and claim the dox were false affected our conversations on this thread. I respectfully disagree that these events are off-topic, given those who injected themselves into the story.
On the subject of Woof, I said upthread that he had a career and reputation to lose and should be expunged from the animal rescue networks he had infiltrated
>>735069 I couldn't be happier to hear that has finally happened.
I don't really buy the story being pedalled at
>>737517 but the right things have now happened.
No. 737802
>>737704
>Posts redacted where posts with information redacted to help the investigation. The investigation into Woof? The replies to half of those posts show that they had nothing to do with Woof. And the replies quoted the posts word for word or had enough info to negate the redaction. If post redaction is necessary for legal reasons in the future, mods should pay closer attention to the replies to fully wipe the redacted info.
>>737721
>I respectfully disagree that these events are off-topic, given those who injected themselves into the story.The "pathetic KF drama" also affected this thread in that Grizzly and the others found an audience here eager to praise them, and they exploited the anonymity offered by LCF when it suited them. Look at how many times they refused to substantiate their claims and how many times Grizzly lied, obfuscated, and backtracked
>>702475 or refused to answer when asked if she was Grizzly.
This screencap
>>702229 of Slimeball saying that Woof was not even Cuban certainly gives me pause.
The hatred of KF on the part of mods and many anons combined with their desire for justice clouded their judgment, just as KF mods' distrust of the fail doxers caused them to discount the legit dox discovered by anons who had never posted on KF.
The anonymous nature of LCF puts us at a disadvantage, and we need to be even more diligent in vetting the doxers and their dox.
No. 737905
>>737802We weren't, as a group, conducting operations here, which I think is an important distinction between this thread and what KF set out to do in this instance. Anonymity is always going to draw the spergs in, just because Grizzly was posting doesn't mean we were all sipping the koolaid on offer.
Null finally got off his ass so now it's moot.
This post you mention at
>>702229 is exactly the thing I have issue with. And then the irony of this staff post
>>707269 in response to our complaints. Who was deceiving who after all? The farmhand in question can feel free to apologise for that accusation anytime.
No. 737906
>>737519Great results regarding the Woof investigation. Good job everyone!
But I'm a bit confused - here the person says that he wasn't arrested after all? Is it an older post and has he actually been arrested since then?
No. 737918
File: 1543154127858.png (156.7 KB, 800x739, woof stream.png)
>>737866Someone corrects him later in the stream. He also misspoke when he said Slimeball physically went to Cuba.
>>737293So his reason for shutting down the discussion of Woof was not something serious like the risk to the photographer but was instead being annoyed by the "hysteria" over the ice cream shop and seeing no reason to pursue Woof since Cuba has no laws against animal cruelty.
Of course, in stating his second reason he is acknowledging that he agreed back then that the dox were correct.
>>737905
>We weren't, as a group, conducting operations hereBy "we" do you mean anons/farmers in general? Grizzly and others certainly tried to make this thread a base of operations after they were kicked from KF. Admin and mods did not seem to know how to handle the activity in this thread. For example, redacting Grizzly's posts which didn't have anything to do with Woof while also issuing her a warning ban for derailing when she answered a question about ZSIS. And so much of what went on would not have been allowed in the average /snow/ thread; it was an outlier on many levels.
No. 738108
>>737918such an asshole. again with the "it's the most autistic ever, you guiz. complete hysteria!!!!". upsetting because who knows what other legitimate leads they'll put down, redact, and/or suppress next time there's a kiddy-diddler or puppy murderer on their hands because they're just "sooo autistic" despite these "autistic" leads being potentially, or actually, fruitful.
>So his reason for shutting down the discussion of Woof was not something serious like the risk to the photographer meanwhile all that the attention-whoring and derailing over "omg the innocents!!" despite, at worst, the dox being of a legitimate cuban dog rapist that distributes zoophilic pornography, just maybe not the one that murdered those dogs in the vids/the one from the telegram group
No. 738194
File: 1543191088895.png (256.81 KB, 2982x960, dcss.PNG)
Hi all.
I was asked to half the Woof conversation, I'll post the screenshot of the discord request. I had no intention to suppress a person like this from being found out. No one told me it was "safe" to talk about woof again, so I never really updated this thread. Sorry for the confusion, I never had bad intentions and was not involved with the investigations. I'm overjoyed he was caught. I want to emphasize that I did not speak to Null about this–he had no part in any of this. The kf retardation has no place here.
No. 738223
>>737964I aim to please.
>>737918Grizzly was posting here to dump info but we, as a board, were not discussing what we would do with that? Unless I missed a whole side conversation where we agreed on action. Reading a Grizzly post does not make me or any other anon complicit in Grizzly's actions.
>>738194I appreciate you coming by in person. I'm sure you weren't trying to hide the id of an animal torturer, I bet no-one thinks that. But that's not the total of the issue. We had information here that was and still is being censored over at KF; information good enough for this guy to get fired over.
Dyn came in here and knowingly derailed with four and a half hours between his first namefagging post and his last, redtexted post. They all have his name on them, it's easy enough to see. The redtexting was also done quite some time after - the next day iirc (but you're in a better position to know that). The farmer who back-talked him after no doubt repeated reports (I know I made them right while he was posting, I'm sure others did too) and hours passing was was redtexted (and presumably temp banned)
>>702105 This was unfair and went beyond just redacting a few things to help with an investigation. Plus I totally agree with them to this day, I think he can handle a few harsh words and staff weren't responding so why not? And I was then accused of "trying to deceive the farm"
>>707269 because I finally got cynical with board staff (after years of patience) about how Dyn's posts were handled in this instance, given his intention. These are several things that contribute to the picture that maybe you wanted conversation suppressed for some reason. The sad truth was probably that you don't have the time and didn't give staff clear direction.
No. 738282
>>738223
>Reading a Grizzly post does not make me or any other anon complicit in Grizzly's actions.?
I don't know how you came to the conclusion that was what I was implying.
No. 738365
>>738194I said this at the time. How did the people who were operating the blackmail ruse expect it to have any weight ("We will keep your identity secret") when Woof had already been named here several days before you got the request
>>698405?
No. 738387
>>738108Both Null and the PM group attempting to blackmail Woof demonstrated bad form. Apparently it was the PM group itself who second guessed whether the dox were correct. Slimeball was a member of the PM group (not to say he was responsible for the ill-conceived blackmail plans or the Discord message to Admin).
>>738223
>We had information here that was and still is being censored over at KFNo, it's not. The post identifying the ice cream shop and the screencap of the memorial page with "Warg Schwarz" were the last two posts about Woof in the megathread before Null stepped in, and they were never removed.
The first pdf
>>735010 was posted early on in the A&H thread, and Woof is being freely discussed there.
Since reading
>>738194 I now am of the opinion that Admin and staff were overwhelmed by the nature and implications of the activity in this thread, and I apologize to Admin for rushing to criticism of the redactions in my earlier comments.
>The kf retardation has no place here.The drama over the blackmail plans would not have been brought here if it weren't for Null.
No. 739038
>>738999I wouldn't read anything into the title change. Titles of posts are changed and updated often on KF. I do wonder where the post was moved from
>>737293.
The news on Woof was simultaneously posted and discussed on page 118 in the Megathread. It was there the link to the first pdf was posted, not the A&H thread as I stated before; I haven't seen the updated pdf posted on KF.
But point taken re there being no thread in Animal Control. AFAIK there was never a thread in Proving Grounds. I don't have an account there.
Null citing the fact that Cuba lacks applicable laws as the reason he declared Woof off limits is irredeemably lame and makes him look like an idiot in light of the developments in the last week.
>>732866
>they believe the dox are probably real but a thread would not be "milky" enough and just be a bunch of a-logging and disgustFunny, because that is what the A&H thread has become.
No. 739666
File: 1543389511148.png (640.01 KB, 1136x3124, Null.png)
Dox Compiler
>>732791 here.
I think our work is just about done. Thanks to all of you: this thread was a humongous source of information for the investigation and the farmers here were exceptionally helpful.
I'm glad we finally did it. Woof's finished.
Since I think you're all owed an explanation of the sequence of events for the past couple of months, I'll try and provide it. Hopefully the following account is useful.
>>738387>Both Null and the PM group attempting to blackmail Woof demonstrated bad form. Apparently it was the PM group itself who second guessed whether the dox were correct. Slimeball was a member of the PM group (not to say he was responsible for the ill-conceived blackmail plans or the Discord message to Admin).The main instigators of the woof blackmail plot were myself and Mono. And this approach did yield results - woof's confession was produced through our turning of the screws on him. Myself and Mono were good on the opsec front, however the other members of the PM chain were not so much and some fags started to leak here.
However, this would not have been so bad had Dynastia not decided to come here and start publicising it on this thread and on KF and caused the entire thing to derail and the plan to be jeopardised.
Myself and Mono were also the main parties responsible for compiling
>>732791 back in early October, and presenting it to the admins. I was very frustrated by some people's behaviour in the PM thread - quite a few people sperged out and started panicking and muddying the water.
Slimeball's enthusiasm and good nature has resulted in amazing progress and woof being broken to the doxers. But Slimeball is an earnest and excitable guy, and more than once he ran his mouth in a detrimental manner. For example: context for
>>702229 is him heading to the Cuban consulate and panicking after the embarrassed political appointment who looked over the case mumbled about how he didn't look like a Cuban from one of the photos she saw.
But I don't even blame him. I blame Null, Dynastia, ZedKissed, and Cricket for grabbing shit like this and disseminating it with no added context and making ridiculous claims that the dox was nonsense.
Around a month before I posted
>>732791, we had this in front of the KF admins. All the putative reasons that were given to hold back the dox were nonsense:
-ZedKissed claimed the entire thing was a setup, and forwarded a bizarre theory that the entire zoosadist leaks were designed to expose all the zoosadists apart from woof (whose evidence from the leakers was apparently uniquely fabricated)
-Cricket claimed woof couldn't be in Cuba because the MARPAT camo he was wearing wasn't available in Cuba. Despite surplus being easy to obtain, and copycat patterns existing virtually everywhere
-Null is the most hilarious. He was tentatively willing to accept the dox, but did a 180 about-face when he got angry and didn't understand a simple counterfactual from Mono (pic related), and then post hoc claimed this was 'pointless' because it was unfunny and he distrusted us
Myself and Mono spent over a week carefully and repeatedly going over their points, trying to generally (tho Mono tended to lose his temper) show how their critiques fell through. However, it got to the point where ZedKissed, Cricket, and Null were just outright insulting us repeatedly and calling us 'amateurs' and 'trolls'. I think at this point Mono quit out of frustration, I lost touch with Slimeball (who only mentioned he was 'going to try a new angle' with the dox me and Mono wrote), and I had a heavy shift pattern at work for the next few weeks.
When I got back, I got stonewalled from KF again, and finally started spreading
>>732791 out of frustration.
I'm very grateful that Slimeball managed to make a break with getting in touch with CEDA, and that this finally showed Null what a faggot he was being.
Here's a public note to you, Null. The case was ironclad nearly 2 months ago, yet you stifled it.
Woof also was at liberty to continue to indulge himself for 2 more months. Because you and your pals were too stubborn, proud, and incestuous to bother, you gave him a window to abuse more animals on the most vapid grounds conceivable. You gave him more chance to gather his resources to get out the country. You gave him more time to destroy evidence.
Forget the humongous disrespect towards the people who put in dozens or even hundreds of hours into this case, to the point where you're continuing to make false claims about us with your buddies and claiming credit for the work that you previously shunned.
You gave woof, a man who desperately needed time, a wealth of it. All because you're a half-literate, thin-skinned, and petty little man.
No. 739696
>>739666Did you present the complete dox posted here as your own to KF? Were members of your group participating in the doxxing here? Because the dox here were solid, contrary to the responses from Null and the other mods.
Was Woof aware of the KF thread? Of this thread?
For the blackmail ruse to have leverage he could not find out about this thread where his dox were already public. I assume the Discord message to Admin
>>738194 was from you or a member of your group. What good was ixnay on the lackmailbay when the dox were still public?
No. 741019
>>738908Woof tries so hard to come across as a tortured soul in his apology but not once does he mention any concern for the dogs he actually tortured, it's all woe is me. It's also laughable that he had any hope of being allowed to put this all behind him and start a new, better life. The only thing he feels sorry for is himself.
This is my first post after lurking for a year, so sorry if I've fucked it up but I needed to thank you all for putting this sick piece of shit behind bars. Good work anons.
No. 741484
>>741387It's in the pdf.
Copied from KF:
I understand your concerns and how difficult it is for you and your team/friends to believe in my sincerity after everything I did and said. I assure you and promise that I DO REGRET FOR EVERYTHING I DID. I PROMISE THAT I WILL NOT DO THE THINGS I DID EVER AGAIN. I ASSURE YOU I’M NEITHER A THREAT NOR A DANGER. I want to find peace and with your help, leave the past buried so that I can start a new life away from my old life. We can stay in contact for as long as I have internet if you want. I have no problems with that and we can talk on telegram if that is ok.
Mr. [Redacted], I don’t see you as my enemy but I admit I fear you. I wrote this down telling the truth in everything I wrote but I fear the uncertainty. I don’t know what you will say. I confess that I’m not sure what your true intentions are and if you don’t seek revenge on me as you said or if all you want is burn me to ashes even after I said that I regret for everything. I don’t know who to trust and what to think at this point.
I’m doing my best to help you understand who I’m I and the events that led us here.
I truly left the wrong path and everything I used to be and do. I left darkness behind and I don’t want to return to it in all my days on this earth. I have prayed god at night asking forgiveness for my evil acts. And have told my closest friend of what I did. I do want to be a new man with all my heart. You saw animal stuff but I saw more than that. Thinking about it makes me cry because I wasn’t able to see the true nature of what I was doing, seeing and listening. It was like a spell. Like two people living in the same body while one could not control the actions of the other.
To tell the truth, that’s a lifestyle that even if you are not caught is a hollow horrible life. You turn into a monstrosity and everything changes without you even noticing. Before you know it you have turned into filth and all values and limits are gone. I don’t know how to describe it. It’s too hard to explain.
I will explain how it started and how it ended.
/////////////////////////////////////////
The only reason I decided to stay and message [woof’s friend] was because I realized that what I did was wrong beyond all scale for evil things and wanted to apologize with him and let him know that I regretted for what I did. Why him? He always was very good to me and I wanted to talk one last time with him. We were friends in not distant past, very good friends. I'd stay up all night not going home to just video chat with him and was awesome. Also wanted to let my old friends know that I was sorry about everything and that I feel I disappointed them all with my actions.
I don't know if [friend] still sees me as a friend but I truly thank him for taking the time to read my letter. He is someone I’ll never forget. I hold good feelings for him and my old friends although I know I’ll not talk to them again. [Friend] and my friends that I met years ago were very good to me and they will be in my memory for ever.
I said to him when he asked (He can confirm) that I'd just stay sitting here waiting for the hammer to fall full force on me.
I'm not in position to ask for anything but I'd like these messages/emails to remain private and that any of this will never be published in public. I will also include a message/letter I sent to my friend [friend] days ago where I explain many things and apologize for everything. That letter was also an apology to my old friends that I met many years ago before I took the wrong path.
That letter was the result of my conclusions after analyzing everything I had done to that day both good and bad, and decided that the path I had taken was not the right thing and not what I wanted for my present life and the future.
/////////////////////////////////////////
This was my letter/message to him:
This message was written to clarify some things and to apologize.
I beg you, read it through. I’m not asking for forgiveness. I’m just explaining my sad story.
First off, I want this message to stay private. This is only for you. You will do whatever you want in the end but since this is a personal message I’d like you keep it to yourself. I want to apologize for many things. I have known you for some time now and we were good friends. We used to talk a lot and I did enjoy our talking. It was me who didn’t have much to say most of the time but still loved to talk with you. I don’t see you as my enemy and don’t have bad feelings for you, but circumstances most likely have made you hate me at this point. I’ve done bad things and I want to apologize for that. I’m apologizing about everything. I feel really bad because I disappointed many good friends like [redacted] among others. I’ll never forget so many years ago when I met you, [redacted]. I said to them that I didn’t have any friends to talk with and they made a small group and invited me so that we could talk, share things and enjoy the best each one of us in the group had to offer. I saw as the group grew up with new members like [redacted]. Don’t know if he is still around but his comments were funny. I remember they wanted to mail me some money for my birthday. I didn’t say much at the time but their generosity and friendship was heart touching and is something I have present in my mind to this day.
They must hate as well and I understand why. I just wanted to say that they have a special place in my memory and heart. I’m sorry that things ended up this way. I wasn’t like this when we met years ago. I stepped into the dark side led by curiosity and a rumor of places where that which you’d think was impossible was actually possible. I did search in secret and after some time, came across places so dark that many would have nightmares for the rest of their lives if they could see what’s in there. Reality would turn unreality and any concept of what good and evil is would just vanish. There were no boundaries, no limits. I was shocked by what I saw and the more I saw it the more I got into it.
The dark world is something peculiar you know. The moment you find it your soul rips in half. A part of you hates it and want to leave it but the other part wants to embrace it and stay. An inner fight takes place in you like to animals fighting.
The problem is that after some time seeing hellish things, you start to see it as just something else not paying special interest to it anymore and even if you see others doing dark things it won’t cause any effect on you. Feels like if a dark spell had been cast upon you. I can’t describe it in any other way.
Now the recent events had a good effect on me albeit a painful one. Reading through posts of people who found leaked content realized that some of the things done were horrible and cruel beyond any possible scale. Their posts made me see things from a different perspective. The perspective of normal loving people made me realize that without noticing I turned into a monster. I was a lurker for the most part. In all that time only did two bad acts for someone else. Contrary to what most people believe, I did not enjoy what I did. It made sad actually and haunted my thoughts for a long time. What made it bearable to some degree was seeing people happy for what I had done which made me feel like it was nothing to worry about and the fact that both animals were stray, in a very sorry state and would have died anyway.
People’s comments made me see the world from my former perspective and broke the spell. The dark places are now gone and just like those places I’m leaving my old life in the past. I’m starting a new life away from everything and will not look back into anything dark in all my days. From now on I want to have a normal life like a normal person and try to forget the past as best as I can.
I made mistakes and was taught a lesson. Lost my friends and will surely have lots of troubles coming my way in the near future. Anyway, I just wanted to apologize for everything and say good bye to my friends.
/////////////////////////////////////////
Want to tell you some stories and a bit about me and dogs.
As I said before I was always an animal lover in the right way. I was born and raised countryside surrounded by animals and loved animals since a short age. Loved and took care of countless animals in my childhood, adolescence and adulthood. I took care of dogs for the most part. Mostly dogs that had been neglected by my neighbors. Helped them in any way I could but was frustrating at times because many owners would not support what I was doing and saw animals die for no reason.
Someone I knew, a neighbor next to my grandma’s house had two beautiful Doberman pups. I loved them. They were so elegant and kind. Always up for jumping playing and running all over the place. One afternoon, the female got a horrible beaten only because she stood up on her hind legs and stole some food item from the table. Suffice to say she came bleeding and I wanted to beat the owner really bad but my mom didn’t let me. This was when I was in high school. One day she got sick with gastroenteritis and her owner left her to die. I offered my savings to buy her in hopes to take to the vet and save her but her owner said no and she died lying against the fence. The male, was killed some months later when they hit him with their car. They didn’t take the time to take him to the vet. At least I stayed there with him till the end. I never forgot them. Their names were Shira and Simba. As a tribute to their memory I put two SS after my name on BF, meaning Wolf Shira and Simba.
The first breed that I had was a stray Doberman. She had a TVT commonly known as a venereal tumor that had not been treated for years and therefore she was in pretty bad condition when I found her. She was active and all but had a hole as wide as a fist in her shoulder and her parts were in bad condition.
She lived around a trash yard where she’d feed on rotten food and the like. One afternoon after I saw her I brought up a pizza that I bought for her and she loved it. That simple act marked the start of our friendship as I started buying pizzas for her almost on a daily basis. She later moved after me and made sort of “nest” in an empty space full of trees next to my home and I made a wooden house for her to keep her dry from rain and fresh from the sun. She lived there and I fed her with dog meat, egg and vegetables every day making her gain some weight. My mom didn’t like her with her wounds but she agreed to accept her at home if I could cure her. Took her to the vet but they said the cancer was too advanced to do anything so I did have her and made her as happy as I could for as long as was possible.
I picked up another stray sometime later and called her Schwarz. She was a Doberman mix and a really happy girl. All black and tan, with a tail like a pointer but shorter and large ears folded back like bat wings. By happy I mean a dog that is hyper active and loves running and going out for walks. Schwarz was how I named her and we were very happy. I miss those days.
She passed away because my mom made me fix her and she got tetanus most likely to reused blades/needles and stuff. Our vet clinics are usually located in garages and places that are not very suitable for such activities. I cried lots when she got sick and passed away. I did everything in my power to save her.
I could continue telling stories of dogs that I had but I don’t think you are interested in stories. Some of the best and most loyal friends I have had were dogs. They have loved me with everything and have been the only ones that have welcomed me wagging tails when my family and everyone else have turned their back on me. I’ve done the same for my dogs. I’ve been loyal to them day and night. They are my pack. When bad things happen and you don’t know where to look, my dogs are the only ones that have been there for me. I really mean it. I’m a dog person. I love dogs even if my recent acts seem to state the opposite.
I was not into anything dark some months ago. A proof of this is the fact that I shared all sort of personal information with many friends both furs and zoos. I did not have any secret at the time, nothing to be afraid of. My nature is to be a very communicative friendly person who likes to talk with friends and share anything. From pics of what I cooked for dinner last night to the beautiful landscapes in the mountains. I’ve been sharing stuff for years. This tells you that I had nothing to hide. Had I been into dark things before, I’d never shared any real life info with them.
/////////////////////////////////////////
This is how my path into the dark started and how it ended. This is my true story and I hope this can serve to prevent others from following my path, a path that leads to self-destruction and pain for oneself and others.
Mr. [Redacted]. If you want to understand what made me do the things I did here it is.
I felt curiosity for dark things after hearing rumors of hidden places where things one would never believe could happen were actually real. Some called it wonderland. Heard of places where reality would turn into unreality. Heard stories of something called, dark web or deep web. I had heard about it in movies but never in real life. Anyway, I started my search for those places in secret and eventually found "mirrors" of those places on telegram. I saw all sort of things that I will not mention here and that I'd rather had never seen… I was introduced to sick music like Bushpig, Snuffporngore, Butcher’s harem, and other very dark music.
I came to places like:
[Redacted].
Those and other places are on Telegram and are real. In all those months I found a few animal groups compared to the darker ones.
I was in shock when I saw what was in those places. If any of you have been there you will know what I talk about and I don’t mean just about animals.
I saw people so dark that animal cruelty would seem like child’ splay compared to the things they did. I saw people who would self-inflict mutilation and wounds in their own bodies with their own hands and cutting tools. I saw a video of someone who removed his own parts…Artists of flesh as I was told they called themselves. I saw all kind of pics about dark, places, rituals, blood gore death, things that it is best not to look at and music that I wish I had never listened.
I was told if you want to find wonderland, you must go all the way down the rabbit’s hole. They didn’t say that wonderland would brand my soul.
Wonderland should actually be called hell land. I was told many things like “Light blinds your eyes, darkness enlights your mind” I was told many thing that twisted my mind and personality. It was a world of depravity and insanity beyond any conception a normal person can have.
Those places and people had an effect on me; my soul was ripping in half. A part wanted to desperately leave. The other wanted to stay. Was a mix of curiosity/hate for those things but was much more and deeper… I was conflicted with myself. A big internal struggle took place in me day and night. Like two opposing forces. Every time I’d ask about it, they’d say it was normal and that would pass away eventually.
Eventually I told to myself it was just my head playing tricks on me because of what I was seeing and after some time, things like gore, death, and all kind of darkness seemed as normal as looking a a fruit hanging from a tree. It was not like I wanted to do any of that in real life but the shock effect those things once had in my person was now gone. Replaced by just apathy or maybe indifference if that is the right word.
I still had good feelings in me. Still loved animals, I had loyalty to my true friends and the like but my indifference to gore, blood and death increased and indifference became obvious. Also started spending more time away from my good old friends from telegram. The ones I talk about above. They are amazing people!!! I would spend more time alone at times. I was changing. I could notice but I could not find out what it was or how to stop it.
There were several dark groups and channels. Many were public at first but became private/secret some time later. I didn’t go to those places looking for anything specific other than rare pictures and music, but after some months of brainwash my mind had changed. Although I didn’t know it, I had been molded to indifference for what I would find later. I was a wanderer for the most part. A lurker when one day someone posted a video of animal stuff which was different to others I had seen involving humans. It was after someone mentioned the word animal referring to the video that I understood what animal cruelty is. This new topic caught my curiosity as I had seen dark things with humans but never with animals. It was that, what opened Pandora’s Box and led me to my demise.
I was introduced to some people into animal animal some time later. The things they did was not nearly what I had seen done to/with humans and dead bodies. It was just some light and often faked bondage and dildo play. I was told this was cruelty. Only saw pictures of this and mostly pics of legs tied in normal position. Not uncomfortable ones that I could see.
Someone invited me to a group some time later and saw more of the same. I looked the same stuff for months not seeing anything new aside from old pics that were traded by people at times.
One day new people joined. They were Shady people. They posted hard pictures that even I had a hard time looking at. This was more similar to Zapp S’kred than anything else and made me wonder I they came from there. One of them said to know the producer. Unlike everyone else, these people liked gore and cruelty and were secretive. They would only say a few words from time to time. I didn’t like those things even at that point but I was just indifferent.
One day I was asked to produce two videos for them. They said everything they’d like to see. I had fear of what I heard. They said they would reward me with things I could not dream of.
I did as they wanted. It tore me apart, but did it. I cheated on them though and lessened things as much as I could. What I got as reward were nightmares for weeks, constant depression and the inability to talk of this to anyone.
They praised me for what I did, were more than happy in their own words. One day they vanished. Their accounts said DELETED.
Took me a long time to recover. Other gore lovers said that I should not worry about it that it was nothing…
I didn’t do anything dark after that but I did stay telling fake stories in a failed attempt to feel any better. My internal conflict had since increased ever since. But again it was partially stopped by people telling me that it was ok and was nothing. I was living in a world of darkness.
One day everything was discovered. It didn’t matter much until I heard people were very angry to say the least. I didn’t understand why until I saw their comments but even after that, I was still trying to figure out why they were so angry. It took me two days to realize why. I was still looking at things from the angle of the dark people and world where I had been the last months. The moment I looked at things and facts from the angle of normal people was like a veil had been removed from my mind and eyes and I cried alone for days, especially at night because I understood the nature of the things I did.
I regretted for everything and wrote a letter to an old friend. It was too late though. I was beyond salvation. The world hated me and I was a monster, an aberration of nature and all. But at least I was conscious of the things I did. I was free now.
I was told to leave, hide and regroup. I said I’d stay and that I’d leave everything behind. Never again I’d step on the path of darkness and evil. Nothing could change the past but maybe I could have a remote chance to change the future.
I said a to a good old friend that I was grateful to the people who called me a monster and that stood up against me because it was thank to them that I saw my mistakes and I asked him to make my message public for everyone to see.
Many bad people are sent to jail every day, many are locked for years, but how many truly change their minds and regret the bad things they did? I don’t have an answer for that.
I don’t know what the future will bring for me. I don’t know if those who know hold power over me will really give me the opportunity to start a new life rather than burn me to ashes as revenge one me but what I do know is that I have regretted for my past actions and that I credit and thank those who did everything in their power to find me and set me free.
That is how it ended.
My advice: Look not only for the dark animals groups but for the human dark groups also. Those groups make you ready to do worst things you can think of. Those places corrupt your mind and who you are and are like a drug. Once you get in you can’t get out easy.
I know the things I did cannot be undone or forgiven. You have the power to destroy me at any time. I’m just asking for a second chance. I’m no longer a threat nor now or in the future.
Don’t do as I did. Please have mercy for that which mercy did not have.
Good day to you.
No. 742881
>>739674Aye. But verifying, collating, and proving beyond reasonable doubt was done by us. We were the ones who shopped it around.
>>739696>id you present the complete dox posted here as your own to KF?See the Gdoc/pdf posted above. Alongside the dox, we presented the proof that all these alts tied together and that tied RMP's personal details with his online persona.
>Were members of your group participating in the doxxing here?Yeah.
>Because the dox here were solid, contrary to the responses from Null and the other mods.It was. Same data presented to them and you. The responses were feeble and I'm 90% sure that the response was due to the fact that Null, Zed, and Cricket were salty that they had been a) beaten to the punch and b) by the methods ('muh fire ants and ice cream') that they derided.
>Was Woof aware of the KF thread? Of this thread?In the brief TG convo I had, he seemed totally unaware. All the info he seemed to have about the search for him seemed to come secondhand from friends.
>For the blackmail ruse to have leverage he could not find out about this thread where his dox were already public. I assume the Discord message to Admin
>>738194 was from you or a member of your group.
That's right.
>What good was ixnay on the lackmailbay when the dox were still public?We relied mostly on woof's ignorance and stupidity, and that those that we believed were tipping him off wouldn't catch wind of this thread. We were 90% sure that the only source woof had on the hunt from him came from mates of his skimming KF. So of course when that retard Dynastia decided to spread everything said here on KF then we had a severe opsec breach (tho the tard who posted our plan here def deserves to be reprimanded).
It seemed to have worked. We got the confession from him.
>>740766Null, senior KF staff. Their egos were hurt because the 'amateurs' they derided for looking for ice cream and fire-ants beat them to the punch and made them look like fools.
No. 748269
>>742881
>Null, senior KF staff. Their egos were hurt because the 'amateurs' beat them to the punchI don't know if I buy that as the reason. The majority of the doxing of the other zoosadists in the megathread was accomplished by non-staff and even a few newbies, and Null doesn't personally dox.
>>748254Because they themselves are vile and disgusting and their closets hide more than just their fursuits.
No. 748454
>>748269There were higher-up users belittling the dox efforts and Null cooperated to suppress discussion of it, even after it was established no deal would be done with Woof. The 'ice cream dox' are till referred to with derision despite being 100% correct.
>>748251Imagine being such a filthy degenerate and so committed to your degenerate circle of friends that protecting this serial animal harmer matters more to you than doing the right thing.
No. 748607
>>748550no word on kero but he’s kind of gone off the map for a while and was apparently under police investigation. locked down his twitter account and has shown no activity since the end of last month.
snakething, the cheerleader of all these sick fucks and someone who’s raped a puppy, was seemingly arrested but was let go shortly after probably due to statute of limitations. no charges were made against him for the pedo shit for whatever reason.
the only one to really suffer any real consequences so far is woof since he lost his job and was actually arrested.
No. 749173
>>748607>snakething, the cheerleader of all these sick fucks and someone who’s raped a puppy, was seemingly arrested but was let go shortly after probably due to statute of limitations. no charges were made against him for the pedo shit for whatever reason.What can be done about this? The thought of this piece of shit walking free makes my stomach turn. Is it too late to bring this Zoosadist shit to the public eye? Normie Twitter? LSA?
It should at least be that if you Google his name, all this shit comes up with his face shown, clear as day.
No. 749234
>>748607>>749173Yeah, came here to ask about everyone else involved, too, now that Woof has finally been arrested. I'm confused. I just read his "apology".
>>741484 I don't understand where Kero and snakething come into play here? Because weren't they talking about the videos "produced" from the dark web in their chat, as if they've seen it too and know all about it, like they're involved in that shit too? In the apology he made it seem like he was talking to some unspeakably evil people who pushed him to make the videos, then he just shares them and talks about them with the other furries? I'm sorry if I'm dumb but I don't get it.
No. 749645
>>749234The key is that woof was lying through his teeth during that confession. I am of the opinion that he wasn't aware of the scale of data we'd had about his activities, or he was banking on investigators not having read it properly.
The content he put out on the ADF chat was confirmed to be original to him, so the fact that he gleefully was sharing it with SnakeThing shows that he was bullshitting when he claimed he was compelled to do it.
That confession wasn't a confession. They were crocodile tears. When pushed via email, woof consistently turned the conversation into being about himself. He wasn't corrupted or forced into anything: he's just a predator making up stories once he got caught.
No. 759308
File: 1546652998366.png (177.6 KB, 1024x613, l7pg2ygq4e821.png)
this thread is pretty much dead but looks like kero got busted for sending dick pics to a minor. heres the twitter thread:
https://mobile.twitter.com/DogpatchPress/status/1080701032693358592 No. 759447
>>759333>>759413I mean, intent is still key in a number of criminal cases. "A person you believed to be a minor" was something the pedos on TCAP got slapped with a lot.
js, regardless of whether they really were underage, Kero believed they were at the time, right? So, still fucking gross, with a sprinkling of possible illegality.
also holy shit woof finally got arrested? haven't seen this thread in a while, going back to catch up now.
No. 759594
>>759447Semi OT
Yes, solicitation of a minor is a felony in some cases and carries prison time. Tho a lot of the idiots on TCAP dug their own grave by sitting down with the police after the show, usually thinking they could talk their way out, but were actually waiving their rights and just giving them more to extend their sentence.
Anyways, many of the guys on that show got several years in prison and of course had to register as sex offenders afterwards.
No. 770481
>>770476shit wtf, i forgot to sage this post but i got an error saying i didn’t post anything anyway and refreshed to make sure nothing posted and this still happened, sorry folks for the bump
In other news, seriously congrats to everyone who helped deal justice to woof. Incredible thread and far more impressive than HWNDU. Thank you all for what you’ve done.
No. 772831
File: 1548659515280.png (148.84 KB, 554x384, Screen Shot 2019-01-27 at 10.5…)
I've been reading this thread for the past couple of days and this is going to be extreme tinfoil but it'll bother me if I don't point it out.
>>733472linked a youtube video about the ADP site and I just happened to pause at a moment where the guy was showing examples of content on the site. The icon caught my eye because it eerily reminds me of this clownfucker on tumblr that goes by tesazombie. I don't know what pointing this out does, this person already seems like a degenerate but this may be a clue that their degeneracy may go farther than what they show on their blog.
>link to their face pagehttp://tesazombie.tumblr.com/tagged/tesaI know this is an extreme shot in the dark but I had to point it out.
No. 773131
>>772831Have you checked the KF Zoosadism thread to see if anyone there has dug up more? I haven't kept up with it in many weeks, and I don't have an account to check Proving Grounds.
Also, Null created a new thread today.
https://kiwifarms.net/threads/furry-personal-army-thread.52687/ No. 911240
File: 1577606838222.png (Spoiler Image,258.17 KB, 2400x1621, c8XTP68.png)
Late update but snakething is in jail
https://kiwifarms.net/threads/levi-dane-simmons-snakething-nelizar-nelizar_neli-buttne.48078/page-42#post-57675377 counts of encouraging child sex abuse
5 counts encouraging sexual assault of an animal
No. 911241
File: 1577606929495.png (257.47 KB, 1320x443, Screenshot_2019-12-29 Levi Dan…)
Wrong image but my post still stands
No. 1072818
File: 1604282785155.png (292 KB, 464x476, 1602391046482.png)
>>1072817
The face of the woman in the video. She's reportedly smiling the whole time she abuses the puppy, breaks its legs, shoves a power drill into its anus, etc.
There are no words for this.
No. 1072821
File: 1604283530707.png (Spoiler Image,3.07 MB, 2048x1228, 1602392429517.png)
>>1072820You're right. Reposting with spoiler, sorry.
I wasn't sure whether to necro this thread or not. I will accept the ban if it's incorrect, but I feel like attention needs to be brought to this, no matter what.
There is be a ring of female zoosadists from Latin-American countries torturing puppies on camera for money. They were discovered by 4chan from one video (I will not directly link it here, but pic related has a description of what happens in it), and they've been trying to track the woman in the video torturing this puppy to death on camera since. To date, they've found multiple other videos, and claim they may have found her handler. There have been no recent updates since, to my knowledge.
These are the threads from 4chan about the subject:
http://archive.4plebs.org/pol/thread/281984881http://archive.4plebs.org/pol/thread/281999505/http://archive.4plebs.org/pol/thread/282015053/https://desuarchive.org/an/thread/3532366/https://desuarchive.org/an/thread/3530363/http://archive.4plebs.org/pol/thread/282029717/http://archive.4plebs.org/pol/thread/282029890/Reddit threads:
https://www.removeddit.com/r/Intern...help_us_identify_this_woman_for_justice_dear/https://www.reddit.com/r/u_LookingForJustice20/comments/j8zjcs/help_us_identify_this_woman_for_justice/I'm not sure what can be done, but I'm posting it in the hopes that someone who knows how to track these sick fucks down is reading this.
>>1072818 is her face.
No. 1072832
>>1072828I know you are making a
valid point anon, but it just isn’t an excuse for being a worthless piece of shit. No amount of money in the world is worth this kind of immoral bullshit - whomever it is being done to. Go sell some fucking fruit or make a basket ffs.
No. 1072845
File: 1604287038383.jpeg (97.38 KB, 684x912, EkuRswWWMAAZzhc.jpeg)
>>1072821Samefagging.
I just discovered that this woman has been tracked down and arrested as of October 19th. Her name is Deyarlick Clarimar Parra Leal. Her "group" also created CP.
I'm really sorry for the confusion, guys. I was just so horrified about this that I acted too impulsively. Either way, I'm glad she has been found. I hope the rest have been exposed, too, and that they'll all be put behind bars.
https://twitter.com/TarekWiliamSaab/status/1318308933711417348 No. 1072891
>>1072845No need to apologize anon, imo. It's good to know that people like this are getting SOME degree of punishment. Plus it can always potentially help with tracking down anyone else connected.
The thoroughness of that cruelty is unbelievable. Damn.
No. 1072970
>>1072828>>1072832This is how this never dies. This woman is obviously missing some crucial part of her humanity, probably due to her upbringing, or else she couldn't even do this. People like her are far beyond buzzwords like "sack of shit", anon, they're fundamentally broken. The only way to get ahead of shit like this and the other sickfuck is to take a deep dive into their lives and fond out how they ended up that way, and prevent it. People don't do shit like this when they had normal lives around normal people, and they don't just "snap" one day and start either. People like her were conditioned to be like this by predators.
Sadly, that'll never happen.
No. 1073208
>>1073011If this were the case, all women in poor countries would be doing this shit.
Instead, most do labor, try to learn some sort of trade, cook, clean, etc. No matter how broke or broken you are, there are plenty of choices that aren't raping and murdering small animals, for fuck's sake.
Just accept that some women are fucked up and intensely sadistic. There's no excuse. Stop patronizing women from poorer parts of the world, this isn't normal or acceptable. In fact, this shit even happens in first world countries. Some of them literally do it for fun, or because they have zero empathy and want easy money to spend on luxuries. "Crush" porn is a whole fucking business full of depraved "humans".
No. 1073978
>>1073967see
>>1072845She went to jail. Rest easy, anon.
No. 1073980
File: 1604414172973.png (108.13 KB, 2748x264, Screenshot 2020-11-01 at 11.05…)
>>1073978Forgot screencap. Hopefully, they're still working on getting the rest of them.
No. 1246979
>>1209375old news. he's already gone again. tried to come back and act like the
victim, people didn't buy his self-pity party bs and he left again.
No. 1247032
>>1209375>>1246979Saged, but what on earth was kero thinking?
He was caught in kahoots with a man who fucked a snake to death and pedophiles. The evidence was posted EVERYWHERE.
What kind of dense morherfucker even attempts a comeback after being exposed like that?
No. 1247061
>>1247036This thread covered only one really sick fuck called woof, Tim win is still at large producing and peddling his shit on the internet, face doxed an all an yet nothing has happened to him. Sepheus is another one who nothing has happened to, intact he grew a new brand from this whole shit.
Nothing is being done about these dogfuckers/torchers.
Levi was the only one to get jail time, an it wasn’t for any of the animal stuff, it was from CP stuff.
No. 1247703
>>1247621You want a thread here on Tim win or his history? I doubt most of us could handle half the stuff the man has done or produced. Trust me I’ve seen a lot of internet an when I looked through his an woofs files I had to nope out of it while crying and needing some bleach. He’s literally 60 years old, been producing content for YEARS. Atleast 30 years for sure with those of the time stamps I’ve seen on his footage. All I can say is, since this thread there’s been a couple people outed in the group doxed, and this thread hasn’t covered any of it.
Doug Spink
Togglerat
Kero’s Dead boyfriend
Eliteknight
Gar
Sepheus
Akela
Many many more not covered here at all. Kiwi farm has a lot more info on this situations they also cover a lot of the background to how this whole leak happened.
No. 1247785
>>1247703I literally had small anxiety attacks after reading…READING…this thread. I didn’t even see or watch any of the fucked up shit.
So, no. Want none of that.
>>1247741Agreed.
No. 1248632
>>1247832>>1247785>>1247741I usually stay out of this thread but seen your replies when scrolling by and got curious. Why oh why did I skim his thread on KF.
Men truly were a mistake.
Is it possible he hasn't been arrested yet because he's also an informant for the FBI? I know statute of limitations for the animal stuff but he must have CP on his computer.
I'd literally kill my husband if I found all this out. No. 1249028
File: 1623108417815.gif (810.74 KB, 500x210, tumblr£ß806cedc047e6086285829f…)
>>1248632ı would cut his fucking weiner, This pedozoo monster deserves to get killed immediately. Those poor animals he suffered…just pure evil.
He also has a whatsapp and seems like hes still active
No. 1249046
File: 1623109334727.jpg (221.29 KB, 1080x2340, Screenshot_2021-06-08-01-26-18…)
>>1249028it seems like hes still active
No. 1249447
File: 1623148626241.jpg (230.75 KB, 1055x811, Screenshot_20210608-113543_Sam…)
>>1249386>>1249024>>1248360He was arrested but Cuba didn't have any animal cruelty laws they could charge him under so he was released. The other farms try to keep an eye on what he's up to
No. 1249453
File: 1623149034179.png (247.94 KB, 755x668, 1617208801574.png)
Whats with youtube and monkey hate autism? Theres full of monkey abuse videos playlist,I think theres a sexual element to this. Still dont know how to format posts well..
No. 1249483
>>1249467I remember a Metokur video about this. Usually they will advertise Telegram groups in the comments or the descriptions where the real CP is shared.
Report that shit if you see it.
No. 1249512
File: 1623156284750.png (Spoiler Image,140.03 KB, 1016x1404, attachments.png)
>>1249379He was assblasted for days haha.
Here's the beginning of his self pity. No dicks or animal harm in this screenshot.
No. 1249601
>>1249532His secret lover that snake guy got arrested for cp. There's chatlogs where they talk about possessing it and going on the dark web to view and share it. Why and how he isn't arrested yet is very suspicious.
This is why I tinfoil that he's an informant.
No. 2019548
File: 1722112196638.png (89.52 KB, 903x1311, 1560111837500.png)
No. 2019549
File: 1722112247168.png (41.9 KB, 903x460, 1560111849600.png)
No. 2019551
File: 1722112438400.png (46.47 KB, 578x348, 1711851417259.png)
Twitter
No. 2019553
File: 1722112525217.png (7.08 KB, 576x84, 1711852448798.png)
Reddit
No. 2019556
File: 1722112616816.png (9.19 KB, 769x67, 1711852809624.png)
Og video
No. 2019561
File: 1722112739083.png (35.66 KB, 614x266, 1711853625648.png)
Cp article on him
No. 2019564
File: 1722112848201.png (73.75 KB, 328x241, 1721676602415.png)
Fuckbook
No. 2019566
File: 1722112961598.png (76.86 KB, 240x300, 1721677078559.png)
One out of his 7 mugshot
No. 2019568
File: 1722113019690.png (13.37 KB, 148x269, 1721678217144.png)
Zoophile web profile
No. 2019570
File: 1722113173679.png (80.25 KB, 981x517, 1721683453842.png)
Horse obsession